KEGG   Gordonia sp. KTR9: KTR9_2789Help
Entry
KTR9_2789         CDS       T02216                                 

Definition
(GenBank) Enoyl-CoA hydratase/carnithine racemase
Organism
gor  Gordonia sp. KTR9
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3229574..3230377)
Genome map
AA seq 267 aa AA seqDB search
MSEQVETESPLLVERHGHVALLTLNRPDRRNAINRAMRKAIKSELWKADADPEVRVIVIT
GAGSAFSSGVDLPEALSGPAPRTEGTTPTQVLRAVSKPVIAAVNGPCYTGAFEFATNCSF
IVASDRAVFSDTHAKIGLLNGWGGSAMLPRAVGLPAAIQIILSGDPVDSATALRIGLANE
VVDHEHLLERTLEIAGSIAESHPGAVQRMLRLLKEGAGASTAHALGLEAEASATFKPDNK
DIGARYDKRQSARVAKASERSAASLQE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaggtcgaaaccgagagtccgttgttggtcgaacgacacgggcacgtggcg
ctgttgaccctcaatcggccggaccggcggaacgcgatcaatcgcgcgatgcgtaaggcc
atcaagagtgaattgtggaaggccgacgcggaccccgaggtgcgggtcatcgtcatcacc
ggggcgggcagcgcattctcgtcgggggtcgatctgcccgaggcgctgtcgggtcccgcc
ccccggaccgagggcaccacaccgacccaggttctccgtgcggtgagtaaaccggtcatc
gctgcggtgaacggtccgtgctacaccggggcgttcgagtttgcgacgaactgctcgttc
atcgtcgcctcggaccgtgctgtgttctccgatacgcacgcaaagatcggactgctcaac
gggtggggtgggagtgcgatgctgccgcgggctgtggggctgcctgcggccatccaaatc
attttgtcgggtgacccggtcgattccgccacagcgcttcgtatcggtctggcgaacgaa
gtcgtggaccatgagcacctgctggagcggacactcgagatcgcgggctcgatcgcggag
agtcaccccggcgcggtgcagcggatgctacggctcctcaaagagggggcaggagcctcc
accgctcatgcgctgggtcttgaggccgaggcttccgcaacattcaagccggacaacaaa
gacatcggtgcccggtatgacaaacgccagtcggccagggtcgcgaaggcgtcggagcgg
tccgcggccagcctgcaggagtga

DBGET integrated database retrieval system