KEGG   Gordonia sp. KTR9: KTR9_2941Help
Entry
KTR9_2941         CDS       T02216                                 

Definition
indoleglycerol phosphate aldolase
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gor  Gordonia sp. KTR9
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gor01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:gor00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:gor00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3401037..3401846)
Genome map
AA seq 269 aa AA seqDB search
MSTQSIPSKLGPVFARCREEGRSALIGYLPVGFPTVEESLTSFRTMVDAGCDIIEVGVPY
SDPVMDGPTIQDAADLALTNGVRVRDVFTAVEAITSAGGNAVVMSYWNPVLKYGVENFAR
DLAEAGGAGLITPNLIPEEGAQWHEAADRHGLDRIYLVAPSSTAERIALTVDASRGFVYA
ASTMGVTGARDAVSDMAPELCARVREYSDIPIGVGLGVRNREQAAQIASYADGVIVGSAL
VTAANAGQDRLASLVSELAEGVRSRRASV
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagcacccagtcgatcccgtccaaactcggccccgtgttcgcccgctgccgggaggag
ggccgcagtgcgctgatcggttacctcccggtcggtttcccgaccgtcgaggagtcgctc
acgtcgttccggacgatggtcgacgccggatgcgacatcatcgaggtcggggtgccctac
tcggacccggtgatggacggcccgacgatccaggatgccgccgacctggccctgaccaac
ggtgtgcgcgtccgtgacgtgttcaccgcggtcgaggccatcacctccgccggtggcaac
gcggtggtcatgagctactggaatccggtgctcaagtacggggtcgagaacttcgcccgc
gatctggccgaggccggcggcgcgggtctgatcacccccaacctgatccccgaagaaggg
gcgcagtggcacgaggcggccgaccggcacggtctcgatcgcatctatctggtcgcgccg
tcgtcgacggccgagcggatcgccctcaccgtcgacgcctcccgcgggtttgtctacgcg
gcgtccacgatgggtgtgaccggtgcgcgagatgcggtgtcggacatggcccccgagctg
tgcgcacgggttcgcgagtactccgacatcccgatcggcgtcgggctcggcgttcgcaac
cgtgagcaggctgcgcagatcgcgtcgtacgccgacggagtcatcgtgggatcggcactg
gtgaccgcggcgaacgcagggcaggatcggttggcctcgctggtctccgaactggccgag
ggtgtccgctcgcgccgggcatcggtctga

DBGET integrated database retrieval system