KEGG   Gordonia sp. KTR9: KTR9_2941Help
Entry
KTR9_2941         CDS       T02216                                 

Definition
(RefSeq) indoleglycerol phosphate aldolase
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gor  Gordonia sp. KTR9
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KTR9_2941
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KTR9_2941
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KTR9_2941
Enzymes [BR:gor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KTR9_2941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3401037..3401846)
Genome map
AA seq 269 aa AA seqDB search
MSTQSIPSKLGPVFARCREEGRSALIGYLPVGFPTVEESLTSFRTMVDAGCDIIEVGVPY
SDPVMDGPTIQDAADLALTNGVRVRDVFTAVEAITSAGGNAVVMSYWNPVLKYGVENFAR
DLAEAGGAGLITPNLIPEEGAQWHEAADRHGLDRIYLVAPSSTAERIALTVDASRGFVYA
ASTMGVTGARDAVSDMAPELCARVREYSDIPIGVGLGVRNREQAAQIASYADGVIVGSAL
VTAANAGQDRLASLVSELAEGVRSRRASV
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagcacccagtcgatcccgtccaaactcggccccgtgttcgcccgctgccgggaggag
ggccgcagtgcgctgatcggttacctcccggtcggtttcccgaccgtcgaggagtcgctc
acgtcgttccggacgatggtcgacgccggatgcgacatcatcgaggtcggggtgccctac
tcggacccggtgatggacggcccgacgatccaggatgccgccgacctggccctgaccaac
ggtgtgcgcgtccgtgacgtgttcaccgcggtcgaggccatcacctccgccggtggcaac
gcggtggtcatgagctactggaatccggtgctcaagtacggggtcgagaacttcgcccgc
gatctggccgaggccggcggcgcgggtctgatcacccccaacctgatccccgaagaaggg
gcgcagtggcacgaggcggccgaccggcacggtctcgatcgcatctatctggtcgcgccg
tcgtcgacggccgagcggatcgccctcaccgtcgacgcctcccgcgggtttgtctacgcg
gcgtccacgatgggtgtgaccggtgcgcgagatgcggtgtcggacatggcccccgagctg
tgcgcacgggttcgcgagtactccgacatcccgatcggcgtcgggctcggcgttcgcaac
cgtgagcaggctgcgcagatcgcgtcgtacgccgacggagtcatcgtgggatcggcactg
gtgaccgcggcgaacgcagggcaggatcggttggcctcgctggtctccgaactggccgag
ggtgtccgctcgcgccgggcatcggtctga

DBGET integrated database retrieval system