KEGG   Gordonia sp. KTR9: KTR9_2942Help
Entry
KTR9_2942         CDS       T02216                                 

Definition
(GenBank) Tryptophan synthase
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gor  Gordonia sp. KTR9
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KTR9_2942
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KTR9_2942
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KTR9_2942
Enzymes [BR:gor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KTR9_2942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3401843..3403189)
Genome map
AA seq 448 aa AA seqDB search
MTAHPDSAHTDVTGATPLPTASVGLTTRTSMEPDEHGHFGVYGGRHVPEALMAVIDEVTT
TFQKVRADDDFLAELDRLQRDYAGRPSPLYEAKRLSEFAGGARIFLKREDLNHTGSHKIN
NVLGQALLAQRMGKHRIIAETGAGQHGVATATACALLGLECVIYMGRVDTDRQALNVARM
RLLGAEVIAVDNGSATLKDAINEAMRDWVTNAHNTYYCFGTAAGPHPFPVMVRDLQRIVG
LEARVQILDKAGRLPDAVTACVGGGSNAIGIFHPFIDDEGVRLVGFEAAGDGVETGRHAA
TFTGGTPGAFQGAYSYLLQDDDGQTIESHSISAGLDYPGVGPEHAYLKDTGRAEYRPITD
TEAMDALALLSRREGIIPAVESAHAVAGALKLGQELGEGAIIVVSLSGRGDKDVDTAARW
FGLFDTPPSQDEATLSASADVQKPGEQA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgcatcctgattccgcccacaccgatgtcaccggggccaccccgctgcccacc
gcgagtgtcgggctgaccacacgcacctccatggaacccgatgagcacgggcatttcggc
gtctacggcgggcgccacgtccccgaggcgctcatggccgtcatcgacgaggtcaccacg
accttccagaaggtccgcgccgacgacgatttcctcgccgagctcgaccgtttgcagcgc
gactacgccggccgcccgtccccgctgtacgaagcgaagcggttgtccgagttcgccggt
ggggcgcgcatcttcctcaagcgcgaggacctcaaccacacgggctcccacaagatcaac
aacgttctcggacaagcgctcctggcccagcggatgggcaagcaccgcatcatcgccgag
accggcgccggccagcacggggtcgccaccgccacggcctgcgcgctcctcggcctcgag
tgcgtgatctacatgggccgggtcgacaccgaccgccaagcgctcaacgtcgcccgcatg
cgtctcctcggtgcggaggtgatcgccgtcgacaacggctcggcgacgctgaaggacgcg
atcaacgaggccatgcgtgactgggtcaccaatgcgcacaacacgtattactgcttcggc
accgccgccggaccgcatccgttcccggtgatggtccgcgatctgcagcgcatcgtcggg
ctcgaggcgcgcgtccagatcctggacaaggccgggcgcctgcccgacgcggtgaccgcg
tgcgtcggtggcggttccaacgcgatcggtatcttccacccgttcatcgacgacgagggt
gtgcggctcgtcggattcgaggccgccggcgacggcgtcgagaccggccggcacgccgcg
accttcaccggcgggacgcccggcgcgttccagggcgcgtactcctacctgttgcaggac
gacgacggtcagaccatcgaatcgcattcgatctcagcgggtctggactatccgggcgtc
gggccggagcatgcgtacctcaaggacaccgggcgtgcggagtaccggccgatcaccgac
accgaggcgatggacgcgctcgccctgctcagccgccgcgaggggatcatccccgccgtc
gagtcggcgcatgcggtcgccggcgccctgaaactcgggcaggagctgggtgagggcgcg
atcatcgtggtcagcctgtccggtcgtggcgacaaggatgtcgacaccgccgcacgctgg
ttcggattgttcgacaccccgccctcgcaggacgaggccaccctctcggcatcggccgac
gtccagaagcccggagagcaggcatga

DBGET integrated database retrieval system