KEGG   Gordonia sp. KTR9: KTR9_2943Help
Entry
KTR9_2943         CDS       T02216                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
gor  Gordonia sp. KTR9
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gor01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:gor00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3403252..3404070)
Genome map
AA seq 272 aa AA seqDB search
MSVPNVLESIIEGVKADVAAREAVVDFASVKAASAKAPAPKDALAALRQPGIGVIAEVKR
ASPSKGELASIGDPAELARAYEEGGARIISVLTEERRFRGSLADLDAVRAAVNIPVLRKD
FIVGTYQIHEARAHGADVILLIVAALEQNVLASLLDRTESLGMTALVEVHTEEEADRALE
AGASVVGVNARNLKTLQVERDTFSRIAPGLPTETIRIAESGVRGTADLLAYAGAGADAVL
VGEGLVTSGDPRAAVRELVTAGTHPSCPKPVR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtgcccaacgttctcgaatcgatcatcgagggagtgaaagccgacgtcgcggct
cgcgaggccgtggtcgacttcgcgtcggtcaaggcggcctcggccaaggctcccgcaccc
aaggatgcactggccgccctgcgccagcccggaatcggcgtcatcgccgaggtcaagcgc
gcgagcccgtcgaagggtgagctcgccagcatcggtgatcccgccgaactcgcccgcgcc
tacgaagagggcggtgcgcgcatcatcagcgtgctcaccgaggaacgacggttccgcggt
tcactcgccgacctcgacgccgttcgcgccgccgtgaacatcccggtgctgcgcaaggac
ttcatcgtcggcacctaccagatccacgaggcccgcgcccacggggcggacgtcattctg
ctgatcgtcgccgctctcgaacagaacgtgctcgcctcgctcctcgaccgcaccgagagc
ctcggcatgaccgcgctcgtcgaggtgcacaccgaggaagaggccgaccgcgccctcgag
gccggcgcctcggtcgtcggcgtcaacgcgcgcaacctcaagaccctccaggtcgagcgc
gacaccttctcccgcatcgcacccggtctgccgaccgagaccatccgcatcgccgagtcg
ggtgtgcgcggtaccgccgatctgctggcctacgccggcgccggcgccgatgccgtactc
gtcggcgaaggtctcgtcaccagtggtgacccgcgtgccgcggtccgtgagctcgtcacc
gcgggtactcacccgtcgtgcccgaaacctgttcgctga

DBGET integrated database retrieval system