KEGG   Gordonia sp. KTR9: KTR9_2955Help
Entry
KTR9_2955         CDS       T02216                                 

Definition
Histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
gor  Gordonia sp. KTR9
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:gor01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:gor00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3412518..3413861)
Genome map
AA seq 447 aa AA seqDB search
MLARIDLRGSTPTLAELRRALPRGGTDVNAVLDTVTPVVHAVADNGTSSALDFGEKFDGV
RPASVRVPAQVIADALAELDPQVADALRESITRARKVHADQRRATTRTQVVDGGVVSEKW
IPVRRVGLYVPGGNAVYPSSVIMNVVPAQEAGVGSLVVASPPQKDFGGWPHPTILAACAL
LGVDEVWAVGGAQGVALLAYGGTDTEQADEPGAVLDPVDLITGPGNIYVTAAKRLCRSVV
GIDSEAGPTEIAILADDSADAGILASDLISQAEHDVLAASVLVTDSAELADAVDAALDTQ
VAATKHRERVTTALSGEQSGVVLVDDLDAGLAVVDAYAAEHLEIQTRDAAAVADRVHNAG
AIFVGPYAPVSLGDYCAGSNHVLPTSGSARFASGLSVQTFLKGVHVIDYDEAALREVADK
VVTLADAEDLPGHGDAVKQRFVKSAAR
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgaattgacctgcgcggtagcacgccgacactcgccgagttgcgtcgtgct
ctgccccgcgggggtaccgatgtcaatgccgtcctcgacacggtgacaccggtcgtgcat
gcggtggccgacaacggcaccagctcggcactcgacttcggcgagaagttcgacggtgtc
cgtcccgcctcggtgcgggtgcccgcgcaggtcatcgccgatgcgcttgccgagctcgac
ccgcaggtcgccgacgcactgcgcgagtcgatcacgcgcgcccgcaaggtccacgccgat
cagcgtcgtgcgaccacgcgcacgcaggtcgtcgacggcggcgtcgtgagcgagaagtgg
ataccggtccgtcgggtcggtctctacgtcccgggtggcaacgcggtgtacccgtcgtcg
gtgatcatgaacgtcgtccccgcgcaggaagccggggtcggctcgttggtcgtcgcctcg
ccgccgcagaaggacttcggcggctggccgcacccgaccattctcgctgcctgcgccctc
ctcggcgtcgacgaggtgtgggccgtcggcggtgcgcagggcgtggcgctgctggcctac
ggcggcaccgacacggagcaggcagacgagccgggcgccgtcctcgacccggtcgacctc
atcaccggtcccggcaacatctacgtcaccgcggccaagcgactgtgccgcagcgtggtg
ggcatcgactccgaggccgggcccaccgagatcgcgatcctcgccgacgactcggcggat
gccggcatcctcgcctccgacctcatcagccaggccgaacacgacgtcctcgccgcctcg
gtgctcgtcaccgacagcgccgaactcgccgacgccgtcgacgccgcgctcgacacccag
gtcgcggccaccaagcaccgcgagcgtgtcaccaccgcgctgtcgggggagcagtcgggt
gtcgtcctggtcgacgatctcgacgccggactggccgtcgtcgacgcctacgctgccgag
cacctcgagatccagacgcgcgacgccgccgcggtcgccgaccgcgtgcacaacgcgggc
gcgatcttcgtcggcccgtacgcaccggtcagtctcggtgactactgtgcaggctccaat
cacgttctgccgacctcgggttcggcccggttcgcgtcgggcctgtcggtgcagaccttc
ctcaagggcgtccacgtcatcgactacgacgaggccgctctgcgtgaggtcgccgacaag
gtggtgacgctggccgacgccgaggacctgcccggtcatggcgacgcggtgaagcagcgc
ttcgtgaagagcgccgcccggtga

DBGET integrated database retrieval system