KEGG   Gordonia sp. KTR9: KTR9_3052Help
Entry
KTR9_3052         CDS       T02216                                 

Definition
Asparagine synthase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gor  Gordonia sp. KTR9
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KTR9_3052
Enzymes [BR:gor01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     KTR9_3052
Peptidases [BR:gor01002]
 Cysteine Peptidases
  Family C44
   KTR9_3052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3525038..3526963
Genome map
AA seq 641 aa AA seqDB search
MCGLLGLLTSDGTAAEVVEPVAVASHCMRHRGPDEPGTWHDDDIVFGFNRLSIIDIEHSH
QPLRWGPPENPDRYALVFNGEIYNYLEIRAELARDEGALFRTEGDSEAIVAAFHHWGPDA
VRRLRGMFAFAIWDTENRSLFLARDPFGIKPLFVASGPGGLIFGSEKKSLLELIERVGLS
SELDPRAIEHYTVLQYVPEPETIHASIRRLESGCHATATPGSPLSIRRYFTPQFGVRPVT
DATRQKRYDEIADVLADSVAKHMRADVTVGSFLSGGIDSTAIAALAIRHNPDLITFTTGF
EREGYSEVDVAAESAEAIGARHVVKVVGPSEFIEAIPSIVWYLDDPVADPALVPLYFVAA
EARKHVKVVLSGEGADELFGGYTIYKEPLSLAAFDRLPRPLRRAAGKISDRIPEGTRGKS
LLHRGSLTLEERYYGNARSFDDARLRAVLRDYRPEWTHTDVTAPIYAMSEGWDPVARMQH
LDLFTWLRGDILVKADKITMANSLELRVPFLDPEVFAIAEGLPHDQKISHGTTKYALRKA
LEQIVPAHVLHRKKLGFPVPIRHWLAGTEMFDWAHDTITHSQTDHIFAKDAVIAMLNEHR
EGVVDNSRRLWTVLMFMVWHGIFVEGTIVPEIIDHTYPVRV
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtggtctgctcggcctgctgacatccgacggaacggccgccgaggtcgtcgaaccg
gtggcggtggcctcgcactgcatgcggcatcgcggacccgacgaacccggcacctggcac
gacgacgacatcgtgttcgggttcaaccgcctttcgatcatcgacatcgaacactcgcat
cagccactccgctggggtccgcccgagaatccggatcggtacgcgctcgtgttcaacggc
gagatctacaactacctcgagatccgtgcggaactcgccagggacgagggcgcgctgttc
cgcaccgagggcgacagcgaggcgatcgtcgccgccttccatcactggggacccgacgcg
gtccggcggctgcgcgggatgttcgcgttcgcgatctgggacaccgagaaccggtcgctg
ttcctcgcgcgtgacccgttcggcatcaagcccctgttcgtggcgtccggtcccggcggg
ctgatcttcggcagcgagaagaagagcctgctcgaactgatcgagcgcgtcggattgtcg
tcggagctcgatccccgcgcgatcgagcactacacggtgctgcagtacgtcccggagccc
gagaccatccatgcctcgatccggcgactggagtcgggctgtcacgccaccgcgacgccg
ggcagtcccctgtcgatccggcggtacttcactccccagttcggtgtccgacccgtcacc
gacgccacccggcagaagcgctacgacgagatcgccgacgtgctcgccgactccgtcgcc
aagcacatgcgggccgacgtcacagtcgggtcgttcctgtccggcggcatcgactcgaca
gccatcgccgcgctagcgatccggcacaacccggacctcatcaccttcaccaccggcttc
gagcgcgagggctactcggaggtcgacgtcgcggccgagtccgcggaggcgatcggcgcg
cggcatgtcgtgaaggtcgtcgggccgtcggagttcatcgaggcgatcccctcgatcgtc
tggtacctcgacgacccggtcgccgatcccgcactcgtcccgctctacttcgtggcggcc
gaggcccgtaagcatgtgaaggtcgtgctgtccggtgagggcgccgacgagctcttcggc
gggtacacgatctacaaggaaccgctgtcgctcgcggccttcgaccggttgccccgaccc
ctgcgccgggcggccggcaagatctccgaccgcatccccgagggaacccgcggtaagagc
ctgctgcaccgcgggtcactcacgctcgaggagcggtactacggcaacgcccgcagcttc
gacgacgcgcggcttcgcgcggtgctccgcgattaccgtccggagtggacccacaccgac
gtcaccgccccgatttacgcgatgagtgagggatgggatccggtggcgcgcatgcagcat
ctggatctgttcacctggctgcgtggcgacatcctggtcaaggcggacaagatcacgatg
gccaactcgctcgagttgcgcgtgccgttcctcgatccggaggtcttcgcgatcgccgaa
ggtctcccccacgaccagaagatctcgcacggcaccacgaaatacgcgttgcgcaaggcg
ctggagcagatcgtcccggcgcacgtcctccaccgcaagaagctcggcttcccggtgccg
atccggcactggctggccgggacggagatgttcgactgggcgcacgacaccatcacgcac
tcgcagaccgatcacatcttcgccaaggacgcggtgatcgcgatgctcaacgagcaccga
gaaggcgtggtggacaacagccgtcgtctctggactgtcctgatgttcatggtctggcac
ggcatcttcgtcgagggcaccatcgttccggagatcatcgaccacacctacccggtgcgc
gtctag

DBGET integrated database retrieval system