KEGG   Gordonia sp. KTR9: KTR9_3065Help
Entry
KTR9_3065         CDS       T02216                                 

Definition
Pyruvate / 2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component,-related enzyme
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gor  Gordonia sp. KTR9
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KTR9_3065
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KTR9_3065
  Amino acid metabolism
   00310 Lysine degradation
    KTR9_3065
Enzymes [BR:gor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     KTR9_3065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3540606..3542486
Genome map
AA seq 626 aa AA seqDB search
MPTAHTPLGITYRPPRRVQEFTTMAFSVQMPALGESVTEGTVTRWLKEEGDTVEADEPLL
EVSTDKVDTEIPAPTSGVLTKIIAQEDDVVEVGGDLALIGDADEADSGSDDSGSDSAGGD
EPTEAAPEPEPEQAAEEPSTDEDAPAEKPTADTGSGSAEGTDVLMPELGESVTEGTVTNW
LKSVGDEVAADEPLLEVSTDKVDTEIPSPVAGTLLEILAQEDDVIEVGGKLAVIGDASAA
PSKKEPEPEPEPEPEPEPEPEQKSEPEPEPEQAPAPEEEQKPAPKAEPKTSEPKSQAAEK
SDPPTVESTPYVTPLVRKLAAENNIDLNAIKGTGVGGRIRKQDVLAAAEEAKAPAPEQKP
AAAAPSAPAASAGKSASPEIRPELAELRGTTQKINRIRQITAKKTRESLQQSAQLTQVFE
VDMTRIAGLRKAAKESFKASEGVNLTYLPFIAKAVVEALKAHPNVNASIDEDKKEITYYD
KVHLGIAVDTPQGLLSPVIHNADDLSIAGLARAIADIAARARSNGLKPDELAGGTFTITN
IGSQGALFDTPILVPPQAAMLGTGAIVKRPVVITGEDGSESIAVRSMSYLPLTYDHRLID
GADAGRFLTTVKKRLEEAAFAADLGL
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
gtgcccacggcgcacacaccattgggcatcacctacagaccaccacgtcgagttcaggag
ttcacaacgatggccttctccgtccagatgcccgcccttggtgaaagtgtcaccgagggg
acagtcacccggtggctgaaggaggagggcgacaccgtcgaggccgacgaaccattgctg
gaggtgtcgaccgacaaggtcgacaccgagatcccggcgcccacttcgggtgtgctgacg
aagatcatcgcccaggaggacgacgtcgtcgaggtcggcggcgacctcgccctgatcggt
gacgccgacgaggccgactccggctcggacgattccggttcggattccgccggcggcgac
gagccgaccgaggccgcccccgagcccgagcccgagcaggccgccgaggagccctccacc
gatgaggacgctcccgccgagaagcccacggccgacaccggttccggctccgcagagggc
accgacgtgctcatgcccgaactcggcgaatcggtcaccgagggcaccgtcaccaactgg
ctgaagtccgtcggcgacgaggtcgccgccgacgaaccgctcctcgaggtctccaccgac
aaggtcgacaccgagatcccctcccccgtcgccggcaccctgctcgagatcctcgcgcag
gaggacgacgtcatcgaggtcggcggcaagctcgccgtcatcggtgatgcctcggcagca
ccgtcgaagaaggagcccgagccggaacccgaaccggaacccgagcccgagcccgagccc
gagcagaagtcggagccggaacccgagcccgagcaggcgcccgcccccgaggaggagcag
aagcccgcaccgaaggccgaaccgaagacctcggagcccaagtcgcaggccgcggagaag
tccgatccgccgaccgtcgagtcgactccgtacgtgaccccgctggtgcgcaagctggcc
gcggagaacaacatcgacctcaacgcgatcaagggcaccggtgtcggtggccggatccgc
aagcaggacgtgctcgccgccgccgaggaggccaaggcacctgctcccgagcagaagccc
gcggcggctgctccgtcggcacccgcggcatcggccgggaagtccgcatcgccggagatc
cgccccgagctggccgagctgcgcgggaccacgcagaagatcaaccgcatccgtcagatc
accgccaagaagacgcgcgagtcgctgcagcagagcgcacagctcacgcaggtcttcgag
gtcgacatgacccgcatcgccggactccgcaaggcggccaaggagagcttcaaggcgtcc
gagggtgtcaacctgacgtacctcccgttcatcgcgaaggccgtcgtggaggcgctgaag
gcgcatcccaacgtcaacgcctcgatcgacgaggacaagaaggagatcacctactacgac
aaggtgcatctcggcatcgccgtcgacaccccgcagggactgctgtcgccggtcatccac
aacgccgatgacctgtcgatcgccggcctggcacgcgccatcgccgacatcgcggcgcgg
gcacgctccaacggactcaagcccgacgagctcgccggcggcaccttcaccatcaccaac
atcggcagtcagggtgcgctcttcgacaccccgatcctggtccccccgcaggccgcgatg
ctcggtaccggagcgatcgtcaagcgtccggtcgtcatcaccggcgaggacggctcggag
tcgatcgcagtgcggtcgatgtcctacctgccgctgacctacgatcaccgtctcatcgac
ggcgccgacgcgggccgcttcctcaccacggtgaagaagcgcctcgaagaggccgccttc
gccgcggacctgggcctctag

DBGET integrated database retrieval system