KEGG   Gordonia sp. KTR9: KTR9_3065Help
Entry
KTR9_3065         CDS       T02216                                 

Definition
Pyruvate / 2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component,-related enzyme
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gor  Gordonia sp. KTR9
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KTR9_3065
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KTR9_3065
  Amino acid metabolism
   00310 Lysine degradation
    KTR9_3065
Enzymes [BR:gor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     KTR9_3065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3540606..3542486
Genome map
AA seq 626 aa AA seqDB search
MPTAHTPLGITYRPPRRVQEFTTMAFSVQMPALGESVTEGTVTRWLKEEGDTVEADEPLL
EVSTDKVDTEIPAPTSGVLTKIIAQEDDVVEVGGDLALIGDADEADSGSDDSGSDSAGGD
EPTEAAPEPEPEQAAEEPSTDEDAPAEKPTADTGSGSAEGTDVLMPELGESVTEGTVTNW
LKSVGDEVAADEPLLEVSTDKVDTEIPSPVAGTLLEILAQEDDVIEVGGKLAVIGDASAA
PSKKEPEPEPEPEPEPEPEPEQKSEPEPEPEQAPAPEEEQKPAPKAEPKTSEPKSQAAEK
SDPPTVESTPYVTPLVRKLAAENNIDLNAIKGTGVGGRIRKQDVLAAAEEAKAPAPEQKP
AAAAPSAPAASAGKSASPEIRPELAELRGTTQKINRIRQITAKKTRESLQQSAQLTQVFE
VDMTRIAGLRKAAKESFKASEGVNLTYLPFIAKAVVEALKAHPNVNASIDEDKKEITYYD
KVHLGIAVDTPQGLLSPVIHNADDLSIAGLARAIADIAARARSNGLKPDELAGGTFTITN
IGSQGALFDTPILVPPQAAMLGTGAIVKRPVVITGEDGSESIAVRSMSYLPLTYDHRLID
GADAGRFLTTVKKRLEEAAFAADLGL
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
gtgcccacggcgcacacaccattgggcatcacctacagaccaccacgtcgagttcaggag
ttcacaacgatggccttctccgtccagatgcccgcccttggtgaaagtgtcaccgagggg
acagtcacccggtggctgaaggaggagggcgacaccgtcgaggccgacgaaccattgctg
gaggtgtcgaccgacaaggtcgacaccgagatcccggcgcccacttcgggtgtgctgacg
aagatcatcgcccaggaggacgacgtcgtcgaggtcggcggcgacctcgccctgatcggt
gacgccgacgaggccgactccggctcggacgattccggttcggattccgccggcggcgac
gagccgaccgaggccgcccccgagcccgagcccgagcaggccgccgaggagccctccacc
gatgaggacgctcccgccgagaagcccacggccgacaccggttccggctccgcagagggc
accgacgtgctcatgcccgaactcggcgaatcggtcaccgagggcaccgtcaccaactgg
ctgaagtccgtcggcgacgaggtcgccgccgacgaaccgctcctcgaggtctccaccgac
aaggtcgacaccgagatcccctcccccgtcgccggcaccctgctcgagatcctcgcgcag
gaggacgacgtcatcgaggtcggcggcaagctcgccgtcatcggtgatgcctcggcagca
ccgtcgaagaaggagcccgagccggaacccgaaccggaacccgagcccgagcccgagccc
gagcagaagtcggagccggaacccgagcccgagcaggcgcccgcccccgaggaggagcag
aagcccgcaccgaaggccgaaccgaagacctcggagcccaagtcgcaggccgcggagaag
tccgatccgccgaccgtcgagtcgactccgtacgtgaccccgctggtgcgcaagctggcc
gcggagaacaacatcgacctcaacgcgatcaagggcaccggtgtcggtggccggatccgc
aagcaggacgtgctcgccgccgccgaggaggccaaggcacctgctcccgagcagaagccc
gcggcggctgctccgtcggcacccgcggcatcggccgggaagtccgcatcgccggagatc
cgccccgagctggccgagctgcgcgggaccacgcagaagatcaaccgcatccgtcagatc
accgccaagaagacgcgcgagtcgctgcagcagagcgcacagctcacgcaggtcttcgag
gtcgacatgacccgcatcgccggactccgcaaggcggccaaggagagcttcaaggcgtcc
gagggtgtcaacctgacgtacctcccgttcatcgcgaaggccgtcgtggaggcgctgaag
gcgcatcccaacgtcaacgcctcgatcgacgaggacaagaaggagatcacctactacgac
aaggtgcatctcggcatcgccgtcgacaccccgcagggactgctgtcgccggtcatccac
aacgccgatgacctgtcgatcgccggcctggcacgcgccatcgccgacatcgcggcgcgg
gcacgctccaacggactcaagcccgacgagctcgccggcggcaccttcaccatcaccaac
atcggcagtcagggtgcgctcttcgacaccccgatcctggtccccccgcaggccgcgatg
ctcggtaccggagcgatcgtcaagcgtccggtcgtcatcaccggcgaggacggctcggag
tcgatcgcagtgcggtcgatgtcctacctgccgctgacctacgatcaccgtctcatcgac
ggcgccgacgcgggccgcttcctcaccacggtgaagaagcgcctcgaagaggccgccttc
gccgcggacctgggcctctag

DBGET integrated database retrieval system