KEGG   Gordonia sp. KTR9: KTR9_3278Help
Entry
KTR9_3278         CDS       T02216                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gor  Gordonia sp. KTR9
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KTR9_3278
   01230 Biosynthesis of amino acids
    KTR9_3278
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KTR9_3278
   00030 Pentose phosphate pathway
    KTR9_3278
   00051 Fructose and mannose metabolism
    KTR9_3278
   00052 Galactose metabolism
    KTR9_3278
  Energy metabolism
   00680 Methane metabolism
    KTR9_3278
Enzymes [BR:gor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KTR9_3278
Protein phosphatases and associated proteins [BR:gor01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KTR9_3278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3769760..3770794)
Genome map
AA seq 344 aa AA seqDB search
MAKRFGILTSGGDCPGLNAVIRGAVLKGETVYGHEFVGFRDGWAGLVYGDIVELNRSTVR
GLSNQGGTILGTSRFGPYSEPDGGPENIKKVLKNLEIDGVIAIGGEGTAAASKRLFDDGI
NIVGVPKTIDNDIAATDYTFGFNTAVEIATEAIDRLRTTGNSHKRCMVLEVMGRHAGWIA
LHSGIAGGAHVILIPENPESLDQICAWVTSVKSRGRSPMVVVAEGFTLPEMKEAHSTKGL
DGFNRPRLGGVAEVLAPLIEERTGIETRATVLGHIQRGGVPSAYDRVLATRMGMATADLV
AEKGWGQMVALHGTEIARITFDEALGELKTVPLDQYKEIRVIFG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaggttcggcattctgacgtccgggggagactgccccggactgaacgcggtg
atccgcggcgcagtgctcaaaggtgagaccgtgtacggccacgagttcgtcgggttccgg
gacggctgggccggactcgtctacggcgacatcgtcgaactgaaccggtcgacggtacgc
ggcctgtccaaccagggcggcaccatcctgggcacgagccggttcggtccctactccgaa
cccgacggcggacccgagaacatcaagaaggtgctgaagaacctcgagatcgacggcgtg
atcgcgatcggcggcgagggcacagcggcggcgtcgaagagactgttcgacgacggcatc
aacatcgtcggggttcccaagaccatcgacaacgacatcgccgccaccgactacacgttc
gggttcaacacggccgtggagatcgccaccgaggccatcgaccggcttcgcaccaccggc
aattcgcacaagcggtgcatggtgctcgaggtgatgggccgccacgccggctggatcgcc
ctgcactccgggatcgcgggcggcgcgcacgtgatcctgatcccggagaatccggagagc
ctcgaccagatctgcgcctgggtcaccagcgtcaagtcgcgcggccgttcaccgatggtc
gtcgtcgccgagggcttcaccctcccggagatgaaggaggcccactccaccaagggcctc
gacggcttcaaccgcccccggctcggcggtgtggccgaggtgctcgccccgctcatcgag
gagcggaccggcatcgagacccgcgccaccgttctcgggcacatccagcgcggcggggtg
ccgtcggcctacgaccgggtcctggcgacacggatggggatggcgaccgccgacctcgtc
gccgagaagggctgggggcagatggtcgccctgcacggcaccgagatcgcgcggatcacc
ttcgacgaggcgctcggcgaactcaagaccgtgccgctggatcagtacaaggagatccgg
gtcatcttcggttga

DBGET integrated database retrieval system