KEGG   Gordonia sp. KTR9: KTR9_3300Help
Entry
KTR9_3300         CDS       T02216                                 

Definition
hypothetical protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gor  Gordonia sp. KTR9
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gor00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3792668..3794302
Genome map
AA seq 544 aa AA seqDB search
MATGTAPVPGQFTLVLHSHLPWLANHGRWPVGEEWLYQSWAASYLPLVDMLERLAADGFT
DQLSLGITPVLAAQLDDPHCASSMYEWLADWQLRATQAAMSRDADRAAAGRREYLDAQRA
LDTFASRWRHGASPLIRGLASSGVAEILGGPLAHPFAPLLDPRLRRFSLDEGLADAHARW
GLDPSGIWAPECAFAPGMETEYDRAGVRHFLVDGPALQGDTALGRPVGDAAVIAYGRDLT
VSYRVWSPKSGYPGHAAYRDFHTYDHETGLKRFRVTGRTVSGEDKKPYDPARVDAVLDRH
VEDFVAHVRTRLVDESDRIGRPALVVAAFDTELFGHWWHEGPVWLERVLRRLPEVGVTVG
TLAGATRAGFVGAPFDLPRSSWGSGKDWRVWNGPAVQHLVDLNAEVTETALDAVAKLRHR
GGERSRVADQIVREALLTVSSDWPFMVSKDTAAQYAVSRAHTHAHATREISDAAMRGRDD
AAETLAANWSRADNLFPALDARRLQTTLTADGIGTETGDAGTGAETGRPADIGPGGIDTE
GEIG
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
gtggccaccggtaccgcgcccgttcccggccagttcacgctggtcctgcattcgcatctg
ccgtggctggccaatcacggccgctggccggtcggcgaggagtggctgtatcagtcgtgg
gcggcgtcgtatctgccgttggtcgacatgctcgagcgtctggccgccgacggcttcacc
gatcagctctccctgggcatcacgccggtactggccgcgcagctcgacgacccgcactgc
gcgtcgtcgatgtacgagtggctcgcggactggcaactgcgggccacccaggccgcgatg
tcccgggacgccgaccgtgcggcggccggacgccgcgagtacctcgacgcccagcgcgct
ctcgacaccttcgcgagccgatggcgtcacggtgcgtcgccgctgatccgcgggctggcc
tcgagcggcgtcgccgagatcctgggcggtccgctcgcccacccgttcgcgccgctgctc
gatccgcgattacgccgcttctcgctcgatgaggggctcgcggacgcgcacgcgcgctgg
ggtctcgacccgtccggcatctgggcgcccgaatgtgccttcgcgccggggatggagacc
gagtacgaccgcgcgggcgtgcgtcacttcctggtcgacggaccggcattgcagggcgac
accgcgctcgggcgccccgtcggtgatgccgccgtcatcgcctacgggcgtgacctgacg
gtgagttaccgcgtctggtcacccaagtcgggctatccgggccacgccgcctaccgcgac
ttccacacgtacgaccacgagaccgggctcaagcggttccgcgtcaccggccggaccgtg
tcgggcgaggacaagaagccctatgacccggcacgggtcgacgcggtcctcgaccggcac
gtcgaggacttcgtcgcgcacgtgcgcacccgcctcgtcgacgagtccgaccggatcggc
cgcccggcgctggtcgtcgcggcgttcgacaccgagctgttcggccactggtggcacgag
gggccggtctggctcgaacgcgtgctccgccgcctgcccgaggtcggggtcaccgtcgga
acactcgcgggcgcgacacgagccgggttcgtcggtgcaccgttcgaccttccccggtcg
tcgtgggggtcgggcaaggactggcgggtgtggaacggcccggccgtgcaacacctggtc
gacctgaacgccgaggtcaccgagacggccctcgacgccgtcgccaagctgcggcaccgg
ggcggcgagcgcagtcgcgtggccgatcagatcgtgcgggaggcgctgctgaccgtgtcg
tcggactggccgttcatggtgtcgaaggacactgccgcgcagtacgctgtgtcgcgagct
cacacgcatgcgcacgccacccgcgagatcagcgacgcggcgatgcgaggccgcgacgac
gctgccgagacgctcgccgcgaactggtcgcgcgccgacaatctgttccccgctctcgat
gcgcgccgtctgcagaccacgctgaccgccgacgggatcggcaccgagaccggcgatgcc
ggaaccggcgccgagaccggccgtccagcggacatcggcccaggggggatcgacaccgag
ggggaaatcggatga

DBGET integrated database retrieval system