KEGG   Gordonia sp. KTR9: KTR9_3355Help
Entry
KTR9_3355         CDS       T02216                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
gor  Gordonia sp. KTR9
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KTR9_3355
  Amino acid metabolism
   00300 Lysine biosynthesis
    KTR9_3355
Enzymes [BR:gor01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     KTR9_3355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3848494..3849594)
Genome map
AA seq 366 aa AA seqDB search
MSIPDLDLTADPVDLTAALVDIESESRNESAIADAVEAALRTQTTGFEIIRHGNRVLART
DRGLAQRVILAGHLDTVPVAGNLPHRRETHPEEGDVLHGCGTVDMKSGDAVFLHLAATLP
EPASDLTLVFYDCEEIAAEFNGLNDIERELPEWLAGDVAILGEPTAGLIEAGCQGTLRVR
LSTTGTRAHSARSWMGDNAIHKLGGVLTTLAGYRARRVDIDGCEYREGLSAVAVGGGVAG
NVIPDAAHVDVNFRFAPDRSVDQALDHVREVFAADLADGTLGLEVTDSAAGALPGLAHPA
AAALVDAAGGRFRAKYGWTDVSRFSALGIPAVNLGPGDPNLAHRVDERVPVEQIRAVTEL
LRAYLS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgagcattcccgatctcgacctgaccgccgaccccgtcgacctgaccgccgcactggtc
gacatcgagagcgagtcgcgcaacgagtccgccatcgccgacgcggtcgaggccgccctg
cgaacgcagacaaccggtttcgagatcatccggcacggcaaccgcgttctcgcgcgcacc
gatcgcggtctcgcccagcgggtcatcctcgccggacacctcgacaccgtgccggtcgcg
ggcaacctcccacaccgtcgtgagacccatcccgaggagggcgacgtcctgcacggatgc
gggaccgtcgacatgaagtccggtgacgcggtgttcctccacctcgcggcgacgctgccc
gagcccgcctcggatctgacactcgtcttctatgactgcgaggagatcgcggcggagttc
aacggcctgaacgacatcgagcgcgagctccccgagtggctggccggcgacgtggcgatt
ctcggcgagcccaccgcggggctcatcgaggcggggtgccagggaacgctgcgggttcgt
ctgtcgacgacgggcacccgtgcgcattcggcccggtcgtggatgggcgacaacgccatt
cacaaactcggcggtgtcctcaccacgctggcgggttatcgggcccgccgggtcgacatc
gacggctgtgagtaccgcgaggggctgtccgcggtcgcggtcggtggcggcgtcgccggt
aacgtgatcccggacgccgcgcacgtcgacgtcaacttccgcttcgcgccggaccgctcg
gtggaccaggcgctcgatcacgtgcgcgaggtgttcgccgccgatctggccgacggcacc
ctcgggctggaggtcaccgattccgccgccggcgccctgcccgggctggcgcatccggcg
gccgcggcgctcgtcgacgccgcgggcgggcgcttccgcgcgaagtacggctggaccgac
gtgtccaggttctcggcgctcgggatcccggccgtgaacctgggtcccggcgaccccaac
ctcgcgcaccgcgtcgacgaacgagtgccggtggagcagatccgcgcggtgaccgaactg
cttcgcgcgtacctgtcctga

DBGET integrated database retrieval system