KEGG   Gordonia sp. KTR9: KTR9_3533Help
Entry
KTR9_3533         CDS       T02216                                 

Definition
Uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gor  Gordonia sp. KTR9
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KTR9_3533
Enzymes [BR:gor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     KTR9_3533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4035556..4036749)
Genome map
AA seq 397 aa AA seqDB search
MNTMTPTGADPAGAGSPEADPLPLAGFTIGITAARRAEEFAALLQRRGAEVMLAPTIRIL
PLVDDTELERVTEELIGNPPEVMVATTGIGFRGWVEAADGWGNAEAVLRALSESRLIARG
PKAKGAIRAAGLREEWSPESESSSEVLDKLLEEGVEGVRIAVQLHGATSEWEPLPDFCTV
LRAAGAQVVPIPVYRWHMHPDVAGIDKMIAAVIRGDLDAITFTSAPAAASILTRAKELGK
LQQFIHALRTAVPVMCVGSVTASPLEALQIPTIYPRRFRLGALARLITDELPRRSHLLRV
AGHDTAIRGQAVVVDGELRDMSATSLLLLKLLARNPGRVVSRQEMLAGLPGDSSDTHAVE
VAVARLRAALGDSKMVQTVVKRGYRLAVDLEYDAEDE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaccatgacccccaccggtgcagaccccgccggcgcaggctccccggaagcggat
ccgctaccgctcgccggcttcacgatcggcatcaccgcggcacgacgcgcggaggaattc
gccgcgttgctccaacgacgcggcgccgaggtgatgctcgccccgaccatccgtatcctg
ccgctggtcgacgacaccgaactcgagcgggtgaccgaggaactcatcgggaacccgccg
gaggtgatggtcgcgacgaccggcatcggtttccgcgggtgggtcgaggcggccgacggc
tggggcaacgccgaggccgtcctgcgtgcgctgtccgagagccggctcatcgcccgcggc
ccgaaggccaagggggcgatccgtgcggcggggttgcgtgaggagtggtcgccggagagc
gagtcctcctccgaggtgctcgacaagctgctcgaagagggcgtcgagggtgtgcggatc
gccgtgcagttacacggcgccaccagcgaatgggaaccgctgccggacttctgcacggtg
ctgcgcgccgccggtgcgcaggtggtgccgattccggtgtaccgctggcacatgcatccc
gacgtggccggcatcgacaagatgatcgcggcggtgatccgcggggacctcgacgcgatc
accttcaccagtgcccccgcggcggcatcgatcctgacccgcgccaaggaactcggcaag
ctgcaacagttcatccatgcgctgcggaccgcggtgccggtcatgtgtgtgggttcggtc
acggccagtccgctggaggcgttgcagatccccacgatctacccgcgccggttccggctc
ggtgctctcgcgcgcctgatcaccgacgagttgccgcggcgcagccacctgctgcgggtc
gccggtcacgacaccgccattcgcggacaggccgtggtggtcgacggcgagctccgcgac
atgtcggcgacgagcctgctcctgctcaagctgttggcccgcaacccgggccgcgtggtg
tcccgccaggagatgctcgccgggttgcccggcgacagctccgacacccatgcggtcgag
gtcgccgtcgcgagactccgcgccgcgctgggtgattcgaagatggtccagaccgtggtc
aaacgaggataccgactggccgtcgacctcgagtacgacgccgaagacgagtga

DBGET integrated database retrieval system