KEGG   Gordonia sp. KTR9: KTR9_3559Help
Entry
KTR9_3559         CDS       T02216                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
gor  Gordonia sp. KTR9
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KTR9_3559
Enzymes [BR:gor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     KTR9_3559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4061998..4064130)
Genome map
AA seq 710 aa AA seqDB search
MNLDRLTALAHRYGVATSYVGWGEKRHDVDPETLVAVLRALEVPAGSPEEIEESIREIDE
QPWREFVPAVTVVTEGSGATFAVHVPHGHLVKVWIVSETGEDVAAPQLDVWVEPREVDDA
LVGRATFAVPDDLPPGYHQIKALDLDDSSASSAPLIVTPRRLHTADRLIGRKRWGLAAQL
YSIRSADSWGVGDFADLAGICEVAASAYGADFVQVNPLHAAQPQAPIEASPYLPVTRRFV
NPLYIRITDIPELDGLSKSQRKWVKALGRSFLTENTATDKIRRNKSFRAKMEALELIYGV
PLVPARASAYRDFRRREGKGLKRFATWCALAERYDADDPRWHGKFLDRAYMKKKRRKLAR
RIDFYMWLQWICDEQLATAAHAARSAGMGIGVMADLAVGVARHSADAWALGDVLASGATV
GAPPDGFNQQGQDWDQPPWHPRRLAEAGYEPYRDMIRTVLRHAGGVRVDHILGLFRLWWI
PDGSSPAHGTYVHYDSEALIGILALEAQRADAVVVGEDLGVFEPSVQDSLRERGILGTSI
LWFEQGPDAAIPPEDYRELCLTSVTTHDLPPTVGYLAGDHITLRSRLGLLASGEDAERAR
DARERDAVLELAYERGLLSRDTPLTDPKVVDALYAVIARTPSVLLSVALVDAVGERRIQN
QPGTDSSQYPNWCVPLANTEGDVVLVEDLVSSVRFRRLVSVLNESGVPGS
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
gtgaacctcgatcggttgaccgcactcgctcaccgctacggcgtcgccaccagctacgtc
ggctggggcgagaagcgtcacgacgtggaccccgagacactggtcgcggtcctgcgggcg
ctcgaggtgcccgcggggtcgcccgaggagatcgaggagtcgatccgcgagatcgacgaa
cagccgtggcgcgagttcgtcccggcggtgacggtcgtgaccgagggctcgggcgccacg
ttcgccgtccacgtcccgcacggtcatctggtgaaggtgtggatcgtcagcgagaccggc
gaggacgtcgcggctccacagctcgacgtctgggtcgaaccgcgcgaggtcgacgacgcc
ctcgtcggccgcgcgacgttcgccgtgcccgatgacctgccgcccgggtatcaccagatc
aaggcactcgacctcgacgactcgtcggcgtcgagtgcgccgctgatcgtcacgccgcgt
cgcctgcacaccgcggaccggttgatcggccgcaaacggtggggactcgccgcgcagctg
tactcgatccgatcggcggattcgtggggcgtgggcgacttcgcggatctcgccggcatc
tgcgaggtggccgcgagcgcgtacggcgccgacttcgtccaggtcaatccgctgcatgcg
gcccagccgcaggcgccgatcgaggcgtccccgtatctgccggtgacgaggcgcttcgtc
aatccgctctatatccggatcaccgacatccccgaactggacgggctgtcgaagtcgcag
cgcaagtgggtcaaggcgctgggtcgcagtttcctcaccgagaacaccgcgaccgacaag
atccggcgcaacaagtccttccgcgccaagatggaggcgctcgaactgatctacggcgtc
ccgctcgtacccgcgcgtgcaagcgcctaccgcgactttcggcgtcgggagggcaagggc
ctcaagcgtttcgcgacgtggtgcgcactcgccgaacgctacgacgccgacgacccgcgc
tggcacggaaagttcctcgaccgcgcgtacatgaagaagaagcgccgaaagctggccagg
cgcatcgacttctacatgtggctgcagtggatctgcgacgaacagctcgccaccgccgcg
catgcggcgcgctccgcgggcatggggatcggcgtgatggccgatctcgcggtgggtgtc
gcacggcacagcgccgacgcgtgggcgctgggcgacgtgctcgcctccggggcgaccgtg
ggagcgccgcccgacggcttcaaccagcagggacaggactgggaccagccgccgtggcat
ccccggcgcctcgccgaggccgggtacgagccgtaccgcgacatgatccgcaccgtcctg
cgacatgcgggaggtgtgcgcgtcgaccacatcctcggactgttccggctctggtggatt
cccgacgggagcagtccggctcacgggacctacgtgcactacgacagcgaagcactgatc
ggcatcctggcgctcgaggcgcaacgcgccgacgcggtcgtcgtcggcgaggatctcggg
gtcttcgagccgtcggtgcaggactcgctccgcgagcgcggaatcctcggcacctcgatc
ctctggttcgaacagggacccgacgcggcaatcccgcccgaggactaccgcgagctgtgc
ctgacctcggtgacgacgcacgacctgccgccgaccgtgggatatctggcgggcgaccac
atcacgctgcgatcgcggctgggcctgctcgcctccggtgaggacgccgagcgggcccgg
gacgcgcgcgaacgcgatgcggtactcgaactggcctacgagcgcggactgctctcccgg
gacaccccgctgacagatcccaaggtcgtcgacgccctgtacgcggtgatcgcacggacc
ccgtcggtgctgctgagcgtcgctctggtggacgcggtgggggagcggcggattcagaac
cagccgggcaccgacagcagccagtatccgaactggtgtgtcccgctggccaataccgag
ggcgacgtcgtcctcgtcgaggatctcgtcagcagcgtgcggttccgcaggctggtgtcg
gtgctcaacgagtcgggcgtgccaggttcctga

DBGET integrated database retrieval system