KEGG   Gordonia sp. KTR9: KTR9_3581Help
Entry
KTR9_3581         CDS       T02216                                 

Definition
Zn-dependent alcohol dehydrogenase
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
gor  Gordonia sp. KTR9
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KTR9_3581
Enzymes [BR:gor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     KTR9_3581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4085944..4086969
Genome map
AA seq 341 aa AA seqDB search
MRAVQVVGYHDKLQLNDVPAPVVTGPLDVIVRIGGAGVCRTDLHILEGQWEEKSGVVLPY
TIGHENAGWVDAIGDAVTNVAVGDKVILHPLITCGLCRACRFGDDVHCENSQFPGIDTDG
GYAEYLKTTARSVVRIDDSLEPAAVAALADAGLTAYHAAAKVARMTRPGDTCVVIGAGGL
GHIGIQVLAAISAVRLIVVDRNPDAVGLAQQIGADVGIVADGSHVEKVLELTGGHGAEAV
LDFVGEGGATAEGTAMLRRAGNFFVVGYGENIDVPTIDVISTEINYIGNLVGSYNDLGEL
MDLAARGKVTLHTSTYALDDFQQALDDLDAGRVRGRAILVP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagtacaggtcgtgggttaccacgacaagttgcaactgaacgacgttccggcg
ccggtggtgaccggcccgctcgacgtgatcgtgaggatcggcggcgcgggggtgtgccgc
accgacctgcacatcctcgagggccagtgggaagagaaatccggtgtggtgcttccatac
acgatcggacacgagaatgccggatgggtcgatgcgatcggggacgcggtcacgaacgtg
gctgtcggcgacaaggtgatcctgcacccgctcatcacgtgcggcctctgccgggcttgc
cggttcggcgacgatgtccactgcgagaacagccagttccccggcatcgacaccgacggc
gggtatgccgagtacctgaagaccaccgctcgcagcgtcgtgcggatcgacgactcactc
gaacccgccgccgtcgccgccctcgccgacgcgggcctgacggcgtatcacgccgccgcc
aaggtcgcccgcatgacgcggcccggtgacacctgcgtggtgatcggcgcgggaggactg
ggccacatcgggatccaggtcctcgccgccatctccgcggtccggctcatcgtggtggac
cgcaaccccgatgccgtcggactcgcgcagcagatcggcgccgacgtcgggatcgtcgcc
gacggttcgcacgtcgagaaggtcctcgaactcaccggcgggcacggcgccgaggccgtg
ctcgacttcgtcggagagggcggggccaccgccgagggcaccgcgatgctgcggcgcgcc
ggcaacttcttcgtcgtcggctacggcgagaacatcgacgtgccgaccatcgatgtgatc
tccaccgagatcaattacatcggcaacctcgtcgggtcctacaacgacctcggggaactg
atggacctcgccgcgcggggaaaagtcacgctgcacaccagcacctacgccctcgacgac
ttccagcaggcgctcgacgacctcgacgcaggccgggtccgcgggcgggcgatcctcgtg
ccctga

  All links  
No link information was found.   
DBGET integrated database retrieval system