KEGG   Gordonia sp. KTR9: KTR9_3720Help
Entry
KTR9_3720         CDS       T02216                                 

Definition
Asparagine synthase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gor  Gordonia sp. KTR9
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:gor00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4280684..4282483
Genome map
AA seq 599 aa AA seqDB search
MCGICGEIRFDGTAPDVSAVDAMTCEMTRRGPDGSGVFSKGSVALGHRRLKIIDLTEKGS
QPMIDPTLGLALVFNGCIYNHHELRAELEGKGYTFFSHADSEVILKAFHAWGPDCVDHFM
GMFAFAIVDTDTGVVTLGRDRLGIKPLYLADTPGRLRFASSVQALLCAGDVDTSIDRVAL
HHYFSFHAVVPAPHTIYNGIRKLPPATVLTIRPDGRRTERRYWEPAFEPHPDRRDWDEKR
WQHELLDSLRTSVRRRMVADVPVGVLLSGGVDSSLVVALLAEQGQTDLATFSIGFDSAAG
ESGDEYAYSDLIADTFGTDHHKIHIGTDRLLPAIPDTVAAMGEPMVSHDCVAFYLLSQEV
SKSIKVVQSGQGADEILGGYSWYPPLLDVTREKTTRAYADVFFDRDDVDIRGILADDYLP
EAGYDPSFEFASAHQSAPGAATAVDAALRLDTTVMLVDDPVKRVDTMTMAWGLEARVPFL
DHEFVELAATCPPDLKLAHGGKGVLKEASRALLPSAVIDRTKGYFPVPGIRHLTGGVLDL
VSDTLRSKAARDRGLYRPAALDRLFADPNRIRTRLDGNELWQVALLEMWLQTMEANARR
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatctgcggtgagatccggttcgacggcacggccccggatgtctcggctgtc
gatgccatgacctgcgagatgacccgccgaggccccgacggctccggcgtcttctcgaaa
ggttctgtcgcgctgggccatcggcgcctgaagatcatcgacctgaccgagaagggcagt
cagccgatgatcgacccgacgctcggcctcgccctggtgttcaacggctgcatctacaac
caccacgaactgcgcgccgaactggagggcaagggttacaccttcttctcccacgccgac
agcgaggtcatcctcaaggcgttccacgcctggggtcccgattgcgtcgaccacttcatg
ggcatgttcgccttcgcgatcgtcgacaccgacaccggcgtggtcactctcggccgcgac
cggctcggcatcaagccgctctacctcgccgacacccccgggcgcctccggttcgcctcg
tcggtgcaggcgctgctgtgcgccggtgacgtcgacacctcgatcgatcgcgtggcgctg
caccattacttcagcttccacgccgtcgtgccggcgccccacacgatctacaacggcatc
cgaaagctcccgcccgcgacggttctgacgatccggcccgacggccggcgtaccgaacgc
cgctactgggaaccggcgttcgagccgcaccccgaccgccgggactgggacgagaagcgg
tggcagcacgagctgctcgactcgctgcggacctcggtgcgcaggcgcatggtcgccgac
gtacccgtcggggtgctgctgtccggcggcgtcgactcctcactcgtcgtcgccctgctc
gccgaacagggccagaccgacctcgccaccttcagcatcggattcgactccgcggccgga
gaatcgggagacgagtacgcctattccgatctcatcgcagacaccttcggcaccgaccac
cacaagatccacatcgggaccgaccggttgttgcccgcgatcccggacacggtcgcggcc
atgggtgaaccgatggtcagccacgactgcgtcgcgttctatctcctctcgcaggaggtc
agcaagtccatcaaggtcgtccagtccgggcagggcgccgacgagatcctcggcgggtac
agctggtatcccccacttctcgacgtgacccgcgagaagacgacgcgcgcctatgccgac
gtcttcttcgaccgcgacgacgtcgacatccgcggcatcctcgccgacgactatctcccc
gaggccggttacgaccccagcttcgagttcgcctcggcccatcagtccgcaccgggcgcc
gcgaccgccgtcgacgcggcgcttcgcctcgacaccaccgtcatgctcgtcgacgacccg
gtgaagcgcgtcgacacgatgacgatggcgtggggactcgaagcccgcgtcccgttcctc
gatcacgagttcgtcgaactggccgccacctgtccccccgatctcaagctcgcgcacggc
ggcaagggcgtgctcaaggaggcgagccgggcgctgctgccgtcggccgtcatcgaccgc
acgaagggttacttcccggtgccggggatccgccacctcaccggcggtgtcctcgacctc
gtctcggacacgctgcgatccaaggccgcccgcgaccgtgggttgtaccggccggcggcg
ctcgatcgactcttcgccgaccccaaccggattcgcaccaggctcgacggcaacgagctg
tggcaggtcgcgctcctcgagatgtggttgcagaccatggaagcgaacgcacgacggtga

DBGET integrated database retrieval system