KEGG   Gordonia sp. KTR9: KTR9_3893Help
Entry
KTR9_3893         CDS       T02216                                 

Gene name
echA19
Definition
(GenBank) Enoyl-CoA hydratase / carnithine racemase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gor  Gordonia sp. KTR9
Pathway
gor00071  Fatty acid degradation
gor00280  Valine, leucine and isoleucine degradation
gor00281  Geraniol degradation
gor00310  Lysine degradation
gor00360  Phenylalanine metabolism
gor00362  Benzoate degradation
gor00380  Tryptophan metabolism
gor00410  beta-Alanine metabolism
gor00627  Aminobenzoate degradation
gor00640  Propanoate metabolism
gor00650  Butanoate metabolism
gor00903  Limonene and pinene degradation
gor00930  Caprolactam degradation
gor01100  Metabolic pathways
gor01110  Biosynthesis of secondary metabolites
gor01120  Microbial metabolism in diverse environments
gor01130  Biosynthesis of antibiotics
gor01212  Fatty acid metabolism
Module
gor_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KTR9_3893 (echA19)
   00650 Butanoate metabolism
    KTR9_3893 (echA19)
  Lipid metabolism
   00071 Fatty acid degradation
    KTR9_3893 (echA19)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KTR9_3893 (echA19)
   00310 Lysine degradation
    KTR9_3893 (echA19)
   00360 Phenylalanine metabolism
    KTR9_3893 (echA19)
   00380 Tryptophan metabolism
    KTR9_3893 (echA19)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KTR9_3893 (echA19)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KTR9_3893 (echA19)
   00281 Geraniol degradation
    KTR9_3893 (echA19)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KTR9_3893 (echA19)
   00627 Aminobenzoate degradation
    KTR9_3893 (echA19)
   00930 Caprolactam degradation
    KTR9_3893 (echA19)
Enzymes [BR:gor01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KTR9_3893 (echA19)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFR50515
UniProt: J9SEZ3
Position
4484323..4485144
Genome map
AA seq 273 aa AA seqDB search
MTTATPAESVTEKAPECLVEKRGHILIVTMNRPEARNALSTEMMRIMTEAWDQVDADPDI
RVAILTGAGGYFCAGADLKSMNKNAPGDTVDSGAWNPASLPALLKGRRLTKPLIAAVEGP
AIAGGTEILQGTDIRVAGESAKFGVSEARWGLYPMGGSAVRLVRQIPYTVACDILLTGRH
ITAREALEYGLIGHVVDDGTALDKALELAEKIAANGPLAVQGILKTIRDTEGLHELDAFE
IDAKIGISVFKSKDAKVGPRAFAEKRTPEFTGE
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagcaacccccgccgagtccgtcaccgagaaggcgcccgagtgcctcgtcgag
aagcgcgggcacatcctgatcgtgacgatgaaccgcccggaggcgcgtaacgcgctctcg
accgagatgatgcggatcatgaccgaggcgtgggatcaggtcgatgccgaccccgacatc
cgcgtggccatcctcaccggcgcgggcgggtacttctgcgcgggcgccgacctcaagagc
atgaacaagaacgcccccggcgacacggtcgattccggcgcctggaatccggcctcgttg
ccggctctgctgaaggggcgccggctcaccaaaccgctcatcgccgcggtggaggggccg
gcgatcgccggcggcaccgagatcctgcagggcaccgacatccgggtggccggcgagagc
gccaaattcggtgtctccgaggctcgttggggcctctacccgatgggcgggagcgcggtt
cgtctcgtccggcagatcccgtacaccgtggcctgcgacatcctgctgaccggccgccac
atcaccgcgcgcgaggcgctcgagtacggcctcatcggccacgtcgtcgacgacggaacc
gccctggacaaggcgctcgaactcgccgagaagatcgcggccaacggccctctcgcggtg
cagggcatcctcaagacgatccgcgacaccgagggcctgcacgaactcgacgccttcgag
atcgacgcgaagatcggcatctcggtcttcaagtcgaaggacgccaaggtgggaccccgc
gcgttcgccgagaagcgcacgccggagttcaccggggagtag

DBGET integrated database retrieval system