KEGG   Gordonia sp. KTR9: KTR9_3943Help
Entry
KTR9_3943         CDS       T02216                                 

Definition
Dihydropteroate synthase-related enzyme
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
gor  Gordonia sp. KTR9
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KTR9_3943
Enzymes [BR:gor01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     KTR9_3943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4535245..4536102)
Genome map
AA seq 285 aa AA seqDB search
MMGVLNVTADSFSDGGRYLDADAAIAHGLELIDQGADLIDVGGESTRPGAVRVDPELETA
RVVPVISELAARGVPVSVDTMRAPVAAAAVEAGAAIVNDVSGGRADADMARVVADAGVPW
ILMHWRPAGDSADRRFTHRSGDVGGYRDVVAEVSGELLAQVDAAVSAGVDADRLILDPGL
GFAKTAEHNWALLHALPTLTGLGFPILVGASRKRFLGTLLSRDGADRPPAGRDVATASVS
ALAAAAGAWGVRVHDVASSRDAVAVAAAWRAGGSRTSSPVGETNG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgatgggtgtcctcaacgtcaccgccgactcgttctccgacggcggtcgctacctcgac
gccgatgcggcgatcgcgcacggtctcgaactgatcgaccagggtgccgacctcatcgac
gtcggcggcgaatcgacccgccccggcgcggtccgggtcgaccccgaactcgagacggcg
cgcgtcgtgccggtgatcagcgaactcgccgcgcgcggggtgcccgtgtcggtcgacacg
atgcgggcgccggtggccgccgcagcggtggaagccggtgcggccatcgtcaacgacgtc
tcgggcgggcgggccgacgccgacatggcacgggtcgtcgcggacgcgggggtgccgtgg
attctcatgcactggcgcccggccggcgacagcgccgaccgtcggttcacccaccgcagc
ggagatgtcgggggttatcgggatgtggtcgccgaggtcagtggtgaactgctcgcccag
gtcgacgccgcggtgtcggccggggtcgatgccgaccgcctgatcctcgacccgggactg
ggcttcgccaagaccgccgaacacaactgggccctgctgcacgccttgcccaccttgacc
gggctgggcttcccgattctggtcggggcctcccgcaaacgtttcctcggcacgctgctc
agccgcgacggcgcggaccgcccgcccgcggggcgcgatgtcgcgaccgcgtccgtctcg
gcactcgccgccgccgcgggtgcgtggggcgtgcgcgtgcacgacgtggcgagcagtcgc
gacgcggtcgcggtcgccgcggcgtggcgcgcaggcggttcccgaacatcatcaccggta
ggagagacgaatggctga

DBGET integrated database retrieval system