KEGG   Gordonia sp. KTR9: KTR9_3996Help
Entry
KTR9_3996         CDS       T02216                                 

Definition
(GenBank) Acyl-coenzyme A synthetase / AMP-(fatty) acid ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gor  Gordonia sp. KTR9
Pathway
gor00010  Glycolysis / Gluconeogenesis
gor00620  Pyruvate metabolism
gor00640  Propanoate metabolism
gor00680  Methane metabolism
gor01100  Metabolic pathways
gor01110  Biosynthesis of secondary metabolites
gor01120  Microbial metabolism in diverse environments
gor01130  Biosynthesis of antibiotics
gor01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KTR9_3996
   00620 Pyruvate metabolism
    KTR9_3996
   00640 Propanoate metabolism
    KTR9_3996
  Energy metabolism
   00680 Methane metabolism
    KTR9_3996
Enzymes [BR:gor01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     KTR9_3996
Lipid biosynthesis proteins [BR:gor01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   KTR9_3996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFR50605
UniProt: J9SFP6
Position
4594270..4595907
Genome map
AA seq 545 aa AA seqDB search
MASPVDTRVREILATYTGDGVDVAHLLCDRHPTEAVALTFVDADRSIRQVTFGELAESSK
RVAAVLAARGVGQGSRVATLMGKSPELLAVVVGIWRLGAVYAPLFTAFAEAAVSSRLVDA
DVTVVIADEDQAHKVPDGTWELVVNTAEASDGSLAALTQAVSAGDVAGQTSVAVGGDGPL
VHMFTSGTTGKPKGVVHPVRYAAGWQSYLEFGLGVDAESVFWCGADPGWAYGLYTAIVAP
LAAGITTTLTRGGFSPQATWAVLDELRVTDYAAAPTVYRGLLTSSDAAPEGLSLKRLSSA
GEPLTPEVNEWAQQVLGLQVHDHYGQTELGMPIGYPHHRLLERPIVAGAMGVSLPGWQMT
VLRTDTDVAADFGEVGQLAVDVTASDFMTFTAYAGNAEATAKRFRGDGRYFLTGDIATID
SDGVIRFSSRDDDVILMAGYRIGPFDVESVLLTHPAVAECAVIAAPDRVRGEVVEAFVVL
ASNWTVDEATTESELQQWVKTHYAAHAYPRQVHLVPTLPKTPSGKIQRAELRKQRREQTT
EGSPS
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggcatcccctgttgacacacgcgtgcgcgagatcctcgccacctacaccggcgacggc
gtcgatgtcgcccacctgctctgcgaccggcaccccaccgaagccgtggcactgacgttc
gtcgacgcggaccgctcgatccggcaggtcaccttcggcgaactggccgagtcgtcgaag
cgggtggccgccgtcctcgccgcgcgcggggtcggtcaggggtcccgagtggcgaccctg
atgggcaagagcccggagttgctggccgtggtcgtgggcatctggcgcctgggcgcggtg
tacgcgccgctgttcaccgcgttcgcggaggccgcggtgtcctcacggctggtcgatgcc
gacgtgacggtggtgatcgccgacgaggaccaggcccacaaagtgcccgacggcacatgg
gaactggtcgtcaacaccgccgaggcctccgacggatccttggccgcgctgacgcaggcg
gtgtccgccggtgacgtggccgggcagacctcggtggccgtcggcggcgacggacccctg
gtccacatgttcacctcgggaaccaccggcaagccgaagggcgtcgtgcacccggtgcgc
tatgccgccgggtggcagagttacctcgagttcggcctcggggtggacgccgagagcgtg
ttctggtgcggcgcggatccgggatgggcctacgggctctacaccgcgatcgtggcaccg
ctcgccgctgggatcaccaccacgctgacccgcggagggttctccccgcaggcgacctgg
gcagtgctcgacgagctgcgcgtgaccgactacgccgccgcgccgacggtgtatcgcggt
ctgttgacctcgtcggacgccgcgccggaggggttgtccctcaagcggttgtccagcgcc
ggcgagccactgacacccgaggtcaacgagtgggcacaacaggtcctcgggttgcaggtc
cacgaccattacgggcagaccgaactgggcatgccgatcggctatccccaccaccggctc
ctcgaacgacccatcgtcgccggcgccatgggggtgtccctaccgggttggcagatgacc
gtcctgcggaccgacaccgatgtcgccgcggacttcggtgaggtgggacagctggccgtc
gacgtcaccgccagcgacttcatgaccttcaccgcttacgccggcaacgccgaggcgacg
gcgaagcgcttccgcggcgacggacgctacttcctgaccggcgacatcgccacgatcgac
tccgacggcgtcatccggttctcctcccgcgacgacgacgtcatcctgatggccggttac
cggatcgggcccttcgacgtcgagtcggtgctgctcacccatcccgcagtcgccgaatgc
gccgtcatcgccgcacccgaccgcgtccggggtgaagtggtcgaggccttcgtcgtgctc
gcatcgaactggaccgtcgacgaggcgaccacggaaagcgaactgcagcaatgggtcaag
acccactacgccgcccacgcctacccccggcaagtgcacctggtcccgaccctgcccaag
accccgagcggcaagatccagcgcgccgaactgcgcaagcagcgccgcgaacagaccacc
gaaggctcgccgtcgtga

DBGET integrated database retrieval system