KEGG   Gordonia sp. KTR9: KTR9_3996Help
Entry
KTR9_3996         CDS       T02216                                 

Definition
Acyl-coenzyme A synthetase / AMP-(fatty) acid ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gor  Gordonia sp. KTR9
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:gor01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gor00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gor00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:gor00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:gor00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4594270..4595907
Genome map
AA seq 545 aa AA seqDB search
MASPVDTRVREILATYTGDGVDVAHLLCDRHPTEAVALTFVDADRSIRQVTFGELAESSK
RVAAVLAARGVGQGSRVATLMGKSPELLAVVVGIWRLGAVYAPLFTAFAEAAVSSRLVDA
DVTVVIADEDQAHKVPDGTWELVVNTAEASDGSLAALTQAVSAGDVAGQTSVAVGGDGPL
VHMFTSGTTGKPKGVVHPVRYAAGWQSYLEFGLGVDAESVFWCGADPGWAYGLYTAIVAP
LAAGITTTLTRGGFSPQATWAVLDELRVTDYAAAPTVYRGLLTSSDAAPEGLSLKRLSSA
GEPLTPEVNEWAQQVLGLQVHDHYGQTELGMPIGYPHHRLLERPIVAGAMGVSLPGWQMT
VLRTDTDVAADFGEVGQLAVDVTASDFMTFTAYAGNAEATAKRFRGDGRYFLTGDIATID
SDGVIRFSSRDDDVILMAGYRIGPFDVESVLLTHPAVAECAVIAAPDRVRGEVVEAFVVL
ASNWTVDEATTESELQQWVKTHYAAHAYPRQVHLVPTLPKTPSGKIQRAELRKQRREQTT
EGSPS
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggcatcccctgttgacacacgcgtgcgcgagatcctcgccacctacaccggcgacggc
gtcgatgtcgcccacctgctctgcgaccggcaccccaccgaagccgtggcactgacgttc
gtcgacgcggaccgctcgatccggcaggtcaccttcggcgaactggccgagtcgtcgaag
cgggtggccgccgtcctcgccgcgcgcggggtcggtcaggggtcccgagtggcgaccctg
atgggcaagagcccggagttgctggccgtggtcgtgggcatctggcgcctgggcgcggtg
tacgcgccgctgttcaccgcgttcgcggaggccgcggtgtcctcacggctggtcgatgcc
gacgtgacggtggtgatcgccgacgaggaccaggcccacaaagtgcccgacggcacatgg
gaactggtcgtcaacaccgccgaggcctccgacggatccttggccgcgctgacgcaggcg
gtgtccgccggtgacgtggccgggcagacctcggtggccgtcggcggcgacggacccctg
gtccacatgttcacctcgggaaccaccggcaagccgaagggcgtcgtgcacccggtgcgc
tatgccgccgggtggcagagttacctcgagttcggcctcggggtggacgccgagagcgtg
ttctggtgcggcgcggatccgggatgggcctacgggctctacaccgcgatcgtggcaccg
ctcgccgctgggatcaccaccacgctgacccgcggagggttctccccgcaggcgacctgg
gcagtgctcgacgagctgcgcgtgaccgactacgccgccgcgccgacggtgtatcgcggt
ctgttgacctcgtcggacgccgcgccggaggggttgtccctcaagcggttgtccagcgcc
ggcgagccactgacacccgaggtcaacgagtgggcacaacaggtcctcgggttgcaggtc
cacgaccattacgggcagaccgaactgggcatgccgatcggctatccccaccaccggctc
ctcgaacgacccatcgtcgccggcgccatgggggtgtccctaccgggttggcagatgacc
gtcctgcggaccgacaccgatgtcgccgcggacttcggtgaggtgggacagctggccgtc
gacgtcaccgccagcgacttcatgaccttcaccgcttacgccggcaacgccgaggcgacg
gcgaagcgcttccgcggcgacggacgctacttcctgaccggcgacatcgccacgatcgac
tccgacggcgtcatccggttctcctcccgcgacgacgacgtcatcctgatggccggttac
cggatcgggcccttcgacgtcgagtcggtgctgctcacccatcccgcagtcgccgaatgc
gccgtcatcgccgcacccgaccgcgtccggggtgaagtggtcgaggccttcgtcgtgctc
gcatcgaactggaccgtcgacgaggcgaccacggaaagcgaactgcagcaatgggtcaag
acccactacgccgcccacgcctacccccggcaagtgcacctggtcccgaccctgcccaag
accccgagcggcaagatccagcgcgccgaactgcgcaagcagcgccgcgaacagaccacc
gaaggctcgccgtcgtga

DBGET integrated database retrieval system