KEGG   Gordonia sp. KTR9: KTR9_4137Help
Entry
KTR9_4137         CDS       T02216                                 

Definition
Sugar kinase, ribokinase family
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
gor  Gordonia sp. KTR9
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KTR9_4137
Enzymes [BR:gor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     KTR9_4137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4756868..4757815)
Genome map
AA seq 315 aa AA seqDB search
MTSHDRATGLLVVGAVNVDLVVETDRLPGPGETVVGPTVTRHGGGKGANAAVAAARAGAE
VRYCGAVGSDDMGAGALDELRDEGVDVTDVAALENVSTGMALIVVDPRGENQIAVGAGAN
GLLTADVVRTAVRRAGGWAGCVLVSTEIPADAVAAAVTTAAERGLRCVVNPAPVPASMVD
LMGSAPVFTPNSSELRDLHALIDDGRDAPEVPAAERAVAVASRTGAPVLVTLGAEGVLIA
NPSGDVLTLPAGHVDEVVDTTGAGDTFNGVFAASLAAGSTVLEAAKRGVAAASLSVGAVG
ARTGMPGDAEIRRAV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacttcccacgatcgagcgaccgggcttctcgtcgtcggcgccgtcaacgtcgatctc
gtcgtggagaccgaccgcttgccgggtcccggtgagacggtcgtcggtccgacggtgact
cggcacggcggcgggaagggcgcgaacgccgccgttgccgctgcgcgtgcgggtgccgag
gtgcgttactgcggcgcagtgggttccgacgacatgggtgcgggcgcactcgacgaacta
cgggacgagggcgtcgacgtcaccgacgtggccgcgctcgagaatgtgtccaccggtatg
gcgctcatcgtcgtcgaccctcgcggagagaaccagatcgcggtgggcgccggcgcgaat
ggcctgctgaccgctgacgtcgtccgtactgcggttcgccgggcgggcggctgggccggg
tgtgtgctcgtcagcaccgagatcccggccgacgccgtcgccgcggccgtcacgacggcg
gccgagcggggtctccgatgcgtcgtcaatcctgccccggtgccggcgtcgatggtcgac
ctcatggggtcggcgccggtgttcacgcccaactcgtcggaacttcgtgacctgcacgcg
ttgatcgacgacggtcgggacgccccggaggtgccggcggccgagcgggcagtggcggtg
gcctcacgtacgggtgcacccgttctcgtgaccctcggtgccgagggtgtgctgatcgcg
aatccgtccggcgacgtgctcaccctccccgccgggcacgtcgacgaggtcgtcgacacg
accggagcgggtgacaccttcaacggcgtgttcgcggcgtcgctcgccgccggttcgacg
gtcctcgaggcggcgaagcggggtgtcgcggcggcgtcgctgtcggtcggcgccgtcggc
gcccggaccgggatgccgggcgatgcggagatccgccgcgcggtgtga

DBGET integrated database retrieval system