KEGG   Gordonia sp. KTR9: KTR9_4301Help
Entry
KTR9_4301         CDS       T02216                                 

Definition
putative beta-glucosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
gor  Gordonia sp. KTR9
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gor00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:gor00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4936652..4937818)
Genome map
AA seq 388 aa AA seqDB search
MTTGTVAVVCAALAACTSSTPDSPPPTPSYSASADAGATSSSASTSATPVANACGATELA
KLSVRQKLAQLIVVGVTGAADAQQIVENEEIGGIFVGSWTDKAILTSGAAARISQNSPIP
LMVTVDQEGGRVSRLSALGIDHASPRELAQTNTPEQVRAIAAGVGRELKSLGVTVDFAPV
ADVSDESDDEVIGDRSFSNDPEVVTRYAGAYAAGLADAGITPVYKHFPGHGHGSGDSHLG
VVTVPSLAELQDSDLVPFRTLLRDPGTAGAMVGHLIVPGLTKGLPASISRPAIQMLRTGV
GYDGPRFDGVIYSDDLSGMAAISAQYPIEQAVEKFILAGGDVALWLSTDRVDSVLDNLER
AVSTGRLAPARLDDKVVRILRSKGVVKC
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacgggaacggtcgccgtggtgtgtgcggcgctcgcggcgtgcacgtcgtcgacg
ccggactcgccaccgccgacgccctcgtactcggcgtcggccgatgcgggggcgacgtct
tcatcggcgtcgacatccgccaccccggtcgcgaacgcttgcggtgcaaccgaactcgcg
aagttgtcggtccgccagaagctcgcgcagctgatcgtcgtcggtgtgaccggggcggcc
gatgcgcagcagatcgtcgagaacgaggagatcggcgggatcttcgtagggagctggacc
gacaaggcgatcctgacaagcggtgcggcagcacggatctcacagaattccccgatcccg
ttgatggtcacggtcgatcaggaaggcggccgggtgtcgcggctctcggccctgggcatc
gaccacgcctcgccgcgcgagctggcgcagaccaacacgcccgagcaggtgcgggccatc
gcggccggcgtgggacgcgagctgaagagcctcggggtcaccgtcgacttcgctcccgtc
gccgacgtcagcgacgaatctgatgacgaggtgatcggcgaccgctccttcagcaacgac
cccgaggtcgtcacccgatatgcgggcgcctacgccgccgggctggccgacgcgggaatc
acgccggtgtacaagcactttccggggcacggacacggctcgggcgactcgcacctgggc
gtcgtgaccgtcccctcgctcgctgagttgcaggacagcgacctcgtgccgttccggacg
ctgttgcgtgaccccgggaccgcgggcgcgatggtcggacacctgatcgtcccgggcctg
acgaagggattgcccgcgagcatcagccggcccgcgatccagatgctgcgcaccggtgtc
ggctacgacggtccgcgcttcgacggcgtgatctactccgacgacctgtcgggcatggcg
gcgatcagcgcgcagtaccccatcgagcaggcggtggagaagttcatcctcgcgggcggc
gacgtcgcgctgtggctgtccaccgaccgcgtcgactcggtgctcgacaacctcgagcgc
gcggtgtcgaccggtcgtctcgcacccgcccgcctcgacgacaaggtggtgcgcatcctg
cggtccaagggtgtggtgaaatgttga

DBGET integrated database retrieval system