KEGG   Gordonia sp. KTR9: KTR9_4438Help
Entry
KTR9_4438         CDS       T02216                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gor  Gordonia sp. KTR9
Pathway
gor00010  Glycolysis / Gluconeogenesis
gor00071  Fatty acid degradation
gor00350  Tyrosine metabolism
gor00625  Chloroalkane and chloroalkene degradation
gor00626  Naphthalene degradation
gor01100  Metabolic pathways
gor01110  Biosynthesis of secondary metabolites
gor01120  Microbial metabolism in diverse environments
gor01130  Biosynthesis of antibiotics
gor01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KTR9_4438
  Lipid metabolism
   00071 Fatty acid degradation
    KTR9_4438
  Amino acid metabolism
   00350 Tyrosine metabolism
    KTR9_4438
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KTR9_4438
   00626 Naphthalene degradation
    KTR9_4438
Enzymes [BR:gor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KTR9_4438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Sacchrp_dh_NADP 2-Hacid_dh_C AlaDh_PNT_C CoA_binding
Motif
Other DBs
NCBI-ProteinID: AFR51042
UniProt: J9RSL8
Position
5089605..5090654
Genome map
AA seq 349 aa AA seqDB search
MRAVQLVQWGAPVEVREIDDPQPNGTELLLRVDAAGLCLSDIHVMDTGAGVFDYPIPLTL
GHEAAGTVIEVGPSADKSWLGRRVVVHGIWACRRCRNCVRGRENYCLRLARNPGAPLPRI
GNGLGHHGGLAEKLLVPSDEVLVPTGDLDPALAAPLADAGLTAFHAIRMNHDLVDESTVA
VVIGIGGLGHMAVQILSALDVASVIAVDKRPEARELASTLGCVAAHASVGEASEAVRSLG
GADLVIDFAGAPSTVESAIGLLGPGGRLVVVGTAGGRVLVGKDLGLAQGWQVGAPFWGTR
SDLTAVVELAASGRLSAETVEFALEDVPRAYELLRRGEVAGRAVVRPNG
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcgggctgtgcaactcgtccaatggggagccccggtcgaggtccgggagatcgacgac
cctcagcccaacggcaccgagcttctcctccgcgtggacgcagcgggcctgtgcctctcg
gacatccacgtgatggacaccggcgccggcgtcttcgattacccgatcccgctgaccctc
ggccacgaggccgcggggacggtcatcgaggtcgggccgtcggcagacaagtcgtggctc
ggccggcgcgtggtcgtgcacggcatctgggcatgccggcgatgccgcaactgtgtacgc
gggcgcgagaactactgccttcgactggcacggaacccgggcgcaccgttgccacgtatc
ggtaacgggcttggccaccacggcggactcgccgagaaactgctcgtgccgtcggatgag
gtcctcgtgccgacaggcgacctcgatccggcgctcgcggctccgctggccgacgccggt
ttgaccgccttccacgccatccggatgaaccacgacctcgtcgacgaatcaacggtcgcg
gtcgtgatcggcatcggcgggctcggccacatggcagtacagatcctctcggcactggac
gtcgcctcggtgatcgccgtcgacaagcgaccggaggcacgcgaactcgcgtcgacgctg
ggttgcgttgccgcgcatgcatcagtcggcgaggcgtccgaggccgtccggagcctgggc
ggcgccgacctcgtcatcgacttcgccggcgcaccgtcgacggtggaatccgccatcgga
ctcctgggccccggtggacggctggtggtggtcgggaccgccggtggacgcgtcctcgtc
ggcaaagacctcggcctcgcacagggatggcaggtgggtgcaccgttctggggaacgcgt
tcggacctgacggcggtcgtcgagctcgctgcgtccggtcggttgtccgcggagacggtc
gaattcgcgctcgaggacgtgccgagggcttatgagctgctgcgacgcggcgaggtcgcc
ggacgtgccgtggtgcgtccgaacggatga

DBGET integrated database retrieval system