KEGG   Gluconobacter oxydans 621H: GOX0170Help
Entry
GOX0170           CDS       T00230                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
gox  Gluconobacter oxydans 621H
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gox00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    GOX0170
Enzymes [BR:gox01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     GOX0170
    3.5.1.-  
     GOX0170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
189831..190403
Genome map
AA seq 190 aa AA seqDB search
MTDLSRSALILVDIQNDFLPGGALAVPDGDGILEAVNALARHPFRAVIATQDWHPPRHCS
FRTQGGPWPVHCVAGTHGADFPQTLLPEPVTHIIRKGVLQGRDSYSGFLDNDRATSTGLD
ELLKGLDIEHVVICGLALDYCVTATALDAVKCGYRTDVVPQACRGIAPDPGDALKKLEKQ
GVLLKSLNTF
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctcagccgctccgctctcatccttgtcgatatccagaatgacttcctgccc
ggcggcgctctggccgttccggacggagatggtattcttgaagccgtcaatgcgcttgcc
agacatccgttcagggcggtcatcgcgacgcaggactggcatcctccccgacactgttcc
ttccgcacgcagggcggtccctggcccgttcactgtgttgccggaactcatggcgcggat
ttcccacaaacgctcctgccggagcctgtgacgcatatcatccgcaagggcgtgctccag
ggacgggacagctattcaggctttctcgataatgaccgtgcaacctcgaccgggctggac
gagttattgaaggggctggacatagagcacgtcgtgatctgcggcctcgcccttgattac
tgcgtaacggccactgcgctggatgccgtgaagtgcggctatcgcacagatgtggttcca
caagcctgcaggggtatcgcaccagaccccggcgatgcgctgaaaaaacttgaaaaacag
ggtgttctgctcaaaagcctgaacactttctga

DBGET integrated database retrieval system