KEGG   Gluconobacter oxydans 621H: GOX0170Help
Entry
GOX0170           CDS       T00230                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
gox  Gluconobacter oxydans 621H
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:gox00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
189831..190403
Genome map
AA seq 190 aa AA seqDB search
MTDLSRSALILVDIQNDFLPGGALAVPDGDGILEAVNALARHPFRAVIATQDWHPPRHCS
FRTQGGPWPVHCVAGTHGADFPQTLLPEPVTHIIRKGVLQGRDSYSGFLDNDRATSTGLD
ELLKGLDIEHVVICGLALDYCVTATALDAVKCGYRTDVVPQACRGIAPDPGDALKKLEKQ
GVLLKSLNTF
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatctcagccgctccgctctcatccttgtcgatatccagaatgacttcctgccc
ggcggcgctctggccgttccggacggagatggtattcttgaagccgtcaatgcgcttgcc
agacatccgttcagggcggtcatcgcgacgcaggactggcatcctccccgacactgttcc
ttccgcacgcagggcggtccctggcccgttcactgtgttgccggaactcatggcgcggat
ttcccacaaacgctcctgccggagcctgtgacgcatatcatccgcaagggcgtgctccag
ggacgggacagctattcaggctttctcgataatgaccgtgcaacctcgaccgggctggac
gagttattgaaggggctggacatagagcacgtcgtgatctgcggcctcgcccttgattac
tgcgtaacggccactgcgctggatgccgtgaagtgcggctatcgcacagatgtggttcca
caagcctgcaggggtatcgcaccagaccccggcgatgcgctgaaaaaacttgaaaaacag
ggtgttctgctcaaaagcctgaacactttctga

DBGET integrated database retrieval system