KEGG   Gluconobacter oxydans 621H: GOX0295Help
Entry
GOX0295           CDS       T00230                                 

Definition
exopolysaccharide production protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
gox  Gluconobacter oxydans 621H
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:gox00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
311382..312179
Genome map
AA seq 265 aa AA seqDB search
MTSASPITVPADDDRALLALAFRLASEASDIINAIRERGFRTDIKDDASPVTEADHASEH
HILSGLRAACPSIPAIGEEEMSAGIRVNAEDAYWLVDPLDGTRGFASGGKDFTVNIGLVR
HDRPVLGVVALPGYGLIYSGGQGLGAHRSDGTNSTPIHTATPPAEGLRVLASSHHGNPEL
LERWLAGRQVASVEKLSSSVKFMRVAEGAADFYPRFGPTMEWDTAAPQAILEAAGGALLD
ETGAPLRYGKPDRLNGSFYCTGGAS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgcctcacccatcaccgtccctgcggacgatgaccgcgcccttctggccctg
gcgttccggctcgcgtccgaagcctcggacatcatcaacgccatccgcgaacgcggcttc
cggacggacatcaaggacgatgcctcccccgtcacggaagcggaccacgcctccgaacat
cacatcctgtcgggcctgcgcgcggcctgcccgtccattcccgccatcggcgaggaagaa
atgtcggccgggatccgggtgaacgcggaagacgcctactggctggtcgatcccctcgac
gggacacgtggctttgcctcgggcggaaaagacttcaccgtcaatatcggcctggtccgc
catgaccgtccggttctgggcgtggttgccctgccgggttacggcctgatctacagcggc
ggacagggcctcggcgcccaccgctcggacggcacaaacagcacgccgatccataccgcc
acaccgcctgcagaaggcctgcgcgttctggcttcgagccatcacggcaatcccgaactt
ctggaacgctggctcgccggacgacaggtcgcctccgtcgagaagctgtcatcctcggtc
aagttcatgcgtgtggccgaaggtgctgcggatttctatccccgtttcggacccacgatg
gaatgggacacggccgctccccaggccattctggaagccgcaggtggagccctgctcgac
gagaccggcgcgcccctgcgctatggcaagccggaccggctgaacggctcattctactgc
accggaggcgcatcttga

DBGET integrated database retrieval system