KEGG   Gluconobacter oxydans 621H: GOX0313Help
Entry
GOX0313           CDS       T00230                                 

Definition
(GenBank) NAD-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gox  Gluconobacter oxydans 621H
Pathway
gox00010  Glycolysis / Gluconeogenesis
gox00071  Fatty acid degradation
gox00350  Tyrosine metabolism
gox00625  Chloroalkane and chloroalkene degradation
gox00626  Naphthalene degradation
gox01100  Metabolic pathways
gox01110  Biosynthesis of secondary metabolites
gox01120  Microbial metabolism in diverse environments
gox01130  Biosynthesis of antibiotics
gox01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gox00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GOX0313
  Lipid metabolism
   00071 Fatty acid degradation
    GOX0313
  Amino acid metabolism
   00350 Tyrosine metabolism
    GOX0313
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GOX0313
   00626 Naphthalene degradation
    GOX0313
Enzymes [BR:gox01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GOX0313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C 2-Hacid_dh_C TrkA_N adh_short 3HCDH_N ELFV_dehydrog UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AAW60096
UniProt: Q5FU50
Position
331428..332459
Genome map
AA seq 343 aa AA seqDB search
MADTMLAAVVREFGKPLSIERLPIPDIKPHQILVKVDTCGVCHTDLHAARGDWPSKPNPP
FIPGHEGVGHIVAVGSQVGDFVKTGDVVGVPWLYSACGHCEHCLGGWETLCEKQDDTGYT
VNGCFAEYVVADPNYVAHLPSTIDPLQASPVLCAGLTVYKGLKMTEARPGQWVAVSGVGG
LGQMAVQYAVAMGMNVVAVDIDDEKLATAKKLGASLTVNAKDTDPARFIQQQIGGAHGAL
VTAVGRTAFSQAMGYARRGGTIVLNGLPPGDFPVSIFDMVMNGTTIRGSIVGTRLDMIEA
MDFFARGKVKSVVTPGKLENINTIFDDLQNGRLEGRTVLDFRS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggctgatacaatgctcgccgccgtcgtccgtgaattcggcaagccgctctccatcgag
cggctacccatcccggacatcaagccccaccagatcctcgtgaaggtcgatacctgtggc
gtctgccacactgacctgcacgccgcgcgcggggactggccgtccaagcccaacccgccg
ttcattcccgggcatgaaggcgtcggacacatcgtcgccgtcggcagtcaggtcggcgat
ttcgtcaagaccggcgatgtcgtgggcgtgccctggctctactccgcctgcggtcactgc
gaacactgtctgggcggctgggaaacactctgcgaaaagcaggacgacaccggctacacc
gtcaatggctgcttcgccgaatatgtcgtggcagacccgaactacgtcgcacacctgccc
tcgaccatcgacccgcttcaggcctcgccggtcctgtgcgcggggctgacggtctataag
ggcctgaaaatgacggaggcccgccccggccagtgggtcgcagtctcgggcgtcggcggt
ctcggccagatggccgtgcagtacgccgtcgccatgggcatgaatgtcgtcgcggtggac
atcgatgacgaaaaactcgccacagccaaaaagctcggcgcatccctgaccgtcaacgcc
aaggacacggacccggccaggttcatccagcagcagatcggcggcgcacatggcgctctc
gtcaccgctgtcggacggacggcgttttcgcaggccatgggctatgcccgccgcggcggc
accatcgtcctgaacggactgccgcccggcgatttcccggtctcgatcttcgacatggtc
atgaacggcaccaccatccgtggctccatcgtcggaacacggctggacatgatcgaggcc
atggatttcttcgcccgcggcaaggtcaaatccgtcgtcacccccggaaaacttgaaaac
atcaatacgatcttcgacgatctgcagaatggtcgcctcgaaggccggacagtgctcgac
ttccggtcctga

DBGET integrated database retrieval system