KEGG   Gluconobacter oxydans 621H: GOX0314Help
Entry
GOX0314           CDS       T00230                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gox  Gluconobacter oxydans 621H
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gox00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    GOX0314
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GOX0314
  Lipid metabolism
   00071 Fatty acid degradation
    GOX0314
  Amino acid metabolism
   00350 Tyrosine metabolism
    GOX0314
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GOX0314
   00626 Naphthalene degradation
    GOX0314
Enzymes [BR:gox01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GOX0314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
332485..333468
Genome map
AA seq 327 aa AA seqDB search
MFAMQLKAHHTPLEWVELPDPEPGPDEIRIRIGACGVCRTDLHVVDGELPHATLPIIPGH
EIVGRIDKLGSNVTGLSVGERVGVPWLGHTCRHCYYCTHGMENLCDHPLFTGFTRNGGYA
TMTVADARYAFPMGDKGEDKDLAPLLCAGLIGWRCLKKAGDGKKIGLYGFGAAAHIITQV
LRWQGREVYAFTSPGDTQKQDFARSLGAVWAGGSDELPPEPLDAVILFAPVGALLPAGLK
AIRKGGKVVCGGIHMSEIPAFSYNTLWEEREIVSVANLTRQDGLEFLKIAPEVGIKVTNT
PYALKDANQALDDLRHGRFDGAAVLLP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccatgcagctcaaagcccatcacacccctctggaatgggtcgaactccccgat
cccgaacccggccccgatgaaatccgcatccggatcggtgcctgcggcgtgtgccggaca
gacctgcatgtcgtggatggcgaactcccccacgccactctccccatcatccccggccac
gaaatcgtcggccggatcgacaagctcggcagcaatgtcacgggtctgtcggtgggcgag
agggtcggcgtgccctggctcggacatacctgcaggcactgctattactgcacgcatggg
atggaaaatctctgtgaccatcccctcttcacaggcttcacccgcaatggcggctacgcg
accatgacggtcgccgatgcccgttacgccttcccgatgggcgacaagggcgaggacaag
gatctcgcgcccctgctctgcgccgggctgatcggctggcgctgcctgaaaaaggcaggg
gacggcaaaaagatcggtctctacggcttcggggcggccgcccatatcatcacgcaggtc
ctgcgctggcagggccgcgaggtctacgctttcacatcgcccggcgatacgcagaaacag
gatttcgcccgctccctcggcgccgtctgggccggtggctcggacgaactcccgcctgaa
ccactggacgccgtcattctgttcgcccccgtcggcgccctgctccccgcgggtctcaaa
gccatccgcaagggcggaaaagtcgtgtgcggcggcatccacatgagcgaaatcccggcc
ttttcctacaacacattgtgggaagagcgcgaaatcgtctccgtcgccaacctgacccgt
caggatggtctggagttcctgaaaatcgccccggaagtcggcatcaaggtgaccaacacg
ccctatgccctgaaagacgccaatcaggccctcgatgacctccggcacggccgtttcgac
ggtgccgccgtattgctgccgtga

DBGET integrated database retrieval system