KEGG   Gluconobacter oxydans 621H: GOX0413Help
Entry
GOX0413           CDS       T00230                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gox  Gluconobacter oxydans 621H
Pathway
gox00010  Glycolysis / Gluconeogenesis
gox00620  Pyruvate metabolism
gox00640  Propanoate metabolism
gox00680  Methane metabolism
gox01100  Metabolic pathways
gox01110  Biosynthesis of secondary metabolites
gox01120  Microbial metabolism in diverse environments
gox01130  Biosynthesis of antibiotics
gox01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gox00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GOX0413
   00620 Pyruvate metabolism
    GOX0413
   00640 Propanoate metabolism
    GOX0413
  Energy metabolism
   00680 Methane metabolism
    GOX0413
Enzymes [BR:gox01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     GOX0413
Lipid biosynthesis proteins [BR:gox01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   GOX0413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N Prot_ATP_ID_OB
Motif
Other DBs
NCBI-ProteinID: AAW60196
UniProt: Q5FTV0
Position
437445..439352
Genome map
AA seq 635 aa AA seqDB search
MSLSSQPHTFRLTPADYGHLVEQATVAPEHYWERESRRLNWSTTPGQAHCTERGWFPGGV
LNASVNCLDRHLETRGDQNALVWQAEETDRVVTFTYRTLHERVCRMANVLREQGVQTGDR
VAIHLPSVPEGLIAMLACARIGAIHVVLFGGFSPEAIADRLSDSGAVLVITANMGRRGPK
RIPFKTTLDAALDLRPEALAVRHVLVVSVTQDDVDLTAGRDLWLTPLLDAASADCAAQDM
PASAPLFLLYTSGSTGKPKGIVHGTGGYLVWASYTHELVFDHQEGDIFWCTADIGWITGH
TYGVYGPLLNGGTILLFEGMPSYPGPGRWWSVIQDHKVTTFYTSPTAIRALMREGDEVVQ
RHDLSSLRVLGTVGEPISQEAWSWFNDHVGGGRCAFVDTWWQTESGGIMISPVPGAVREK
PASATLPLPGVHPVLLDERGAPKEGATEGVLCLRGSWPGRALTIWNDAALFERTYLQSYP
GYYFTGDGARRDEDGYYWITGRVDDVINVSGHRIGSAEIEDALATELAIAESAAIGVPHD
LKGQGIVVYLVPRDNAPEDLHIRAAKAITSKVGRYAAPERIHVVPDLPKTRSGKSVRRLL
RKIACGETEGFGDLSTLADPEIVATLIALIQVPKS
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttcctcccaacctcatacattccgcctgactccggcggactatggccatctg
gtggagcaggccactgtcgcgcctgaacattactgggagcgtgagagcagacggctgaac
tggagcaccacgcccggtcaggctcattgcaccgaacgcggctggtttccgggtggggtg
ctcaatgcgagcgtcaactgcctggaccggcatcttgagacgcgcggcgatcagaacgcc
cttgtctggcaggccgaagagaccgaccgggttgtgaccttcacctaccggacactccac
gagcgcgtctgccgcatggcgaacgtgctgcgtgagcagggcgtgcagaccggggaccgg
gttgccattcacctgccgtccgtgcctgaaggcctgatcgccatgcttgcctgcgcgcgg
atcggagccatccacgtggttcttttcggcgggttttctccggaagcgatcgccgaccgg
ctgtctgacagtggcgcagtgctggtcattaccgccaatatgggacgccgcggtcccaag
cggatccccttcaagacgacgctggacgccgctctggacctccgtccggaagctctcgcc
gtcaggcatgttctggtcgtgagcgtgacgcaggacgacgttgatctgacggcgggacgg
gacctgtggctgaccccccttctggacgcggcatcggccgactgcgctgcgcaggacatg
ccggcctccgccccgctgttcctgctgtacacatcgggcagtaccggaaagcccaagggg
atcgtacatggcacgggcggctatctggtctgggcatcctacacccatgaactggttttc
gatcatcaggaaggcgacatcttctggtgcacggccgatatcggctggatcaccggccat
acctatggcgtttacggccccctgctgaatggcgggacgattctgctgttcgaaggcatg
ccgtcctatccgggaccaggccgctggtggagcgtcattcaggaccacaaggtcacgacg
ttctatacgtctcctaccgcaatccgcgctctcatgcgcgaaggcgatgaggttgtgcag
cgtcatgacctctcctcgctgcgcgttctggggactgtcggcgagcctatcagccaggaa
gcctggtcctggttcaatgatcatgtcgggggcggccgctgcgctttcgtcgatacctgg
tggcagacggaaagcggtgggatcatgatttcgcccgttccgggcgccgtccgggagaaa
ccggcttccgccacgctccccctgcccggtgtccatccggttcttctggacgaacgcggc
gctccgaaagaaggcgcaacggaaggtgtgctctgcctcagaggttcctggcccggccga
gcgctcacgatctggaatgatgcggcccttttcgagcgcacctatcttcagtcctatccc
ggctactatttcaccggtgacggcgcgcggcgtgacgaggacgggtattactggatcacc
ggacgcgttgacgacgtgatcaacgtctccggacaccggatcggatctgccgagatcgaa
gacgctctggcgactgaactggctatcgcggaaagtgcggcgatcggcgttccccacgac
ctcaagggacagggaatcgtcgtctatctcgtcccgcgcgataacgcgcccgaagatctt
cacatccgggcggccaaggccatcacgtcaaaagtgggccgctatgcggcgccggagcgc
atccatgtcgtgccggaccttcccaagacccgttcggggaaaagcgttcgccgcctgctt
cgcaagattgcgtgcggagagaccgaaggatttggtgatctctccaccctcgccgatcct
gagatcgtcgcaacgctgatcgcgctgatccaggtgccgaaaagctga

DBGET integrated database retrieval system