KEGG   Gluconobacter oxydans 621H: GOX1073Help
Entry
GOX1073           CDS       T00230                                 

Definition
(GenBank) Dihydrolipoamide succinyl transferase (E2) of 2-oxoglutarate dehydrogenase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gox  Gluconobacter oxydans 621H
Pathway
gox00020  Citrate cycle (TCA cycle)
gox00310  Lysine degradation
gox01100  Metabolic pathways
gox01110  Biosynthesis of secondary metabolites
gox01120  Microbial metabolism in diverse environments
gox01130  Biosynthesis of antibiotics
gox01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gox00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GOX1073
  Amino acid metabolism
   00310 Lysine degradation
    GOX1073
Enzymes [BR:gox01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GOX1073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl HrpJ Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AAW60842
UniProt: Q5FS04
Position
1176960..1178069
Genome map
AA seq 369 aa AA seqDB search
MTVEIRVPALGESLTTATVARWLKKSGDYVQHDETIVELETDKVSVEVTAPSAGRLEDCV
AVGTEVEIGGLLGAVDETAEAPAAPEPAPVAEAPAEPAAPPPAPEPVAQPARVAPPAPEA
PKPAAVAPAPKLSSHEARERRVPMSRLRQTIARNLKAAQNTAAILTTFNEIDMSAAKALR
AQYKEEFEKKHDGARLGFMSFFARAVVGALKDYPAINAQIEGDEIVYRDFVNLGIAVGTE
RGLVVPVLHDADQMSFAELERRIADYGKRARTGGLKLEELSHGTFSITNGGIFGSLLSTP
ILNTPQSGILGMHAIQDRPVVRDGQIVIRPMMYVALSYDHRIVDGREAVSFLVRIKQLVE
DPRRLLLDL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcgagatcagggttccggcgcttggagaaagcctgacgactgcgactgtcgcg
cggtggcttaaaaaatccggcgactatgtgcagcatgacgaaaccatcgtggagctggag
acggacaaggtcagcgtcgaggtgacggcgccgtccgccgggcgtctggaagactgcgtg
gctgttgggacggaagtcgagatcggtgggctgctgggcgctgtggacgagacggcagag
gcaccggctgcgcctgagcctgctccggtggctgaagcgcctgccgaaccggctgctcca
ccgccagcacccgaacctgttgcacagcctgcgcgcgtggccccgcccgcaccggaagcg
ccaaagcccgctgctgttgctccggcccccaagctgtcatcgcatgaagcgcgggaacgt
cgcgtaccgatgagccgtctgcgtcagacgatcgcccgtaatctgaaggctgcgcagaac
acggcggccattctcacgacgttcaacgagatcgacatgtccgccgccaaggcgctgcgg
gcacagtacaaggaagagttcgagaagaagcatgacggggcccggctgggcttcatgtcc
ttcttcgcgcgcgcagtggtcggggcgctgaaggattatccggcgatcaatgcgcagatc
gaaggcgatgagatcgtctaccgtgatttcgtcaatctcggcattgcggtcgggacggag
cgcgggctggttgtgccggtgctgcatgatgccgatcagatgagctttgccgagctggag
cgtcgtattgccgattatggcaagcgggcgcggacgggcgggctgaagctggaggaactg
tctcatgggacgttctccatcacgaatggcgggattttcggatcgctgctgtccacgccg
atcctgaacacgccgcagtcgggaatcctggggatgcatgccattcaggatcgaccggtc
gtgcgggacgggcagattgtgatccggccgatgatgtatgttgcgctgtcttatgatcac
cggatcgtggacgggcgggaggcggtgagcttcctggtccggatcaagcagcttgtggaa
gatccgcggcgtctgcttctggatctgtga

DBGET integrated database retrieval system