KEGG   Gluconobacter oxydans 621H: GOX1073Help
Entry
GOX1073           CDS       T00230                                 

Definition
dihydrolipoamide succinyl transferase (E2) of 2-oxoglutarate dehydrogenase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gox  Gluconobacter oxydans 621H
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gox00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GOX1073
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GOX1073
  Amino acid metabolism
   00310 Lysine degradation
    GOX1073
Enzymes [BR:gox01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GOX1073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1176960..1178069
Genome map
AA seq 369 aa AA seqDB search
MTVEIRVPALGESLTTATVARWLKKSGDYVQHDETIVELETDKVSVEVTAPSAGRLEDCV
AVGTEVEIGGLLGAVDETAEAPAAPEPAPVAEAPAEPAAPPPAPEPVAQPARVAPPAPEA
PKPAAVAPAPKLSSHEARERRVPMSRLRQTIARNLKAAQNTAAILTTFNEIDMSAAKALR
AQYKEEFEKKHDGARLGFMSFFARAVVGALKDYPAINAQIEGDEIVYRDFVNLGIAVGTE
RGLVVPVLHDADQMSFAELERRIADYGKRARTGGLKLEELSHGTFSITNGGIFGSLLSTP
ILNTPQSGILGMHAIQDRPVVRDGQIVIRPMMYVALSYDHRIVDGREAVSFLVRIKQLVE
DPRRLLLDL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcgagatcagggttccggcgcttggagaaagcctgacgactgcgactgtcgcg
cggtggcttaaaaaatccggcgactatgtgcagcatgacgaaaccatcgtggagctggag
acggacaaggtcagcgtcgaggtgacggcgccgtccgccgggcgtctggaagactgcgtg
gctgttgggacggaagtcgagatcggtgggctgctgggcgctgtggacgagacggcagag
gcaccggctgcgcctgagcctgctccggtggctgaagcgcctgccgaaccggctgctcca
ccgccagcacccgaacctgttgcacagcctgcgcgcgtggccccgcccgcaccggaagcg
ccaaagcccgctgctgttgctccggcccccaagctgtcatcgcatgaagcgcgggaacgt
cgcgtaccgatgagccgtctgcgtcagacgatcgcccgtaatctgaaggctgcgcagaac
acggcggccattctcacgacgttcaacgagatcgacatgtccgccgccaaggcgctgcgg
gcacagtacaaggaagagttcgagaagaagcatgacggggcccggctgggcttcatgtcc
ttcttcgcgcgcgcagtggtcggggcgctgaaggattatccggcgatcaatgcgcagatc
gaaggcgatgagatcgtctaccgtgatttcgtcaatctcggcattgcggtcgggacggag
cgcgggctggttgtgccggtgctgcatgatgccgatcagatgagctttgccgagctggag
cgtcgtattgccgattatggcaagcgggcgcggacgggcgggctgaagctggaggaactg
tctcatgggacgttctccatcacgaatggcgggattttcggatcgctgctgtccacgccg
atcctgaacacgccgcagtcgggaatcctggggatgcatgccattcaggatcgaccggtc
gtgcgggacgggcagattgtgatccggccgatgatgtatgttgcgctgtcttatgatcac
cggatcgtggacgggcgggaggcggtgagcttcctggtccggatcaagcagcttgtggaa
gatccgcggcgtctgcttctggatctgtga

DBGET integrated database retrieval system