KEGG   Gluconobacter oxydans 621H: GOX1073Help
Entry
GOX1073           CDS       T00230                                 

Definition
(RefSeq) dihydrolipoamide succinyl transferase (E2) of 2-oxoglutarate dehydrogenase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
gox  Gluconobacter oxydans 621H
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gox00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GOX1073
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GOX1073
  Amino acid metabolism
   00310 Lysine degradation
    GOX1073
Enzymes [BR:gox01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GOX1073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1176960..1178069
Genome map
AA seq 369 aa AA seqDB search
MTVEIRVPALGESLTTATVARWLKKSGDYVQHDETIVELETDKVSVEVTAPSAGRLEDCV
AVGTEVEIGGLLGAVDETAEAPAAPEPAPVAEAPAEPAAPPPAPEPVAQPARVAPPAPEA
PKPAAVAPAPKLSSHEARERRVPMSRLRQTIARNLKAAQNTAAILTTFNEIDMSAAKALR
AQYKEEFEKKHDGARLGFMSFFARAVVGALKDYPAINAQIEGDEIVYRDFVNLGIAVGTE
RGLVVPVLHDADQMSFAELERRIADYGKRARTGGLKLEELSHGTFSITNGGIFGSLLSTP
ILNTPQSGILGMHAIQDRPVVRDGQIVIRPMMYVALSYDHRIVDGREAVSFLVRIKQLVE
DPRRLLLDL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcgagatcagggttccggcgcttggagaaagcctgacgactgcgactgtcgcg
cggtggcttaaaaaatccggcgactatgtgcagcatgacgaaaccatcgtggagctggag
acggacaaggtcagcgtcgaggtgacggcgccgtccgccgggcgtctggaagactgcgtg
gctgttgggacggaagtcgagatcggtgggctgctgggcgctgtggacgagacggcagag
gcaccggctgcgcctgagcctgctccggtggctgaagcgcctgccgaaccggctgctcca
ccgccagcacccgaacctgttgcacagcctgcgcgcgtggccccgcccgcaccggaagcg
ccaaagcccgctgctgttgctccggcccccaagctgtcatcgcatgaagcgcgggaacgt
cgcgtaccgatgagccgtctgcgtcagacgatcgcccgtaatctgaaggctgcgcagaac
acggcggccattctcacgacgttcaacgagatcgacatgtccgccgccaaggcgctgcgg
gcacagtacaaggaagagttcgagaagaagcatgacggggcccggctgggcttcatgtcc
ttcttcgcgcgcgcagtggtcggggcgctgaaggattatccggcgatcaatgcgcagatc
gaaggcgatgagatcgtctaccgtgatttcgtcaatctcggcattgcggtcgggacggag
cgcgggctggttgtgccggtgctgcatgatgccgatcagatgagctttgccgagctggag
cgtcgtattgccgattatggcaagcgggcgcggacgggcgggctgaagctggaggaactg
tctcatgggacgttctccatcacgaatggcgggattttcggatcgctgctgtccacgccg
atcctgaacacgccgcagtcgggaatcctggggatgcatgccattcaggatcgaccggtc
gtgcgggacgggcagattgtgatccggccgatgatgtatgttgcgctgtcttatgatcac
cggatcgtggacgggcgggaggcggtgagcttcctggtccggatcaagcagcttgtggaa
gatccgcggcgtctgcttctggatctgtga

DBGET integrated database retrieval system