KEGG   Gluconobacter oxydans 621H: GOX1201Help
Entry
GOX1201           CDS       T00230                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gox  Gluconobacter oxydans 621H
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gox00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GOX1201
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GOX1201
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GOX1201
Enzymes [BR:gox01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GOX1201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1312135..1313373
Genome map
AA seq 412 aa AA seqDB search
MTNTPSPLSPPLANSLRSGPDDRGRFGIFGGRFVAETLMPLLLELDEAYRAAQADPEFRK
ELDYYLKDYVGRPSPLWFAQHLTEELGGAKVYFKREELNHTGSHKLNNVMGQILVARRMG
KTRIVAETGAGQHGVATATVCALFGLKCTIYMGATDVERQKPNVFRMHLLGAEVKPVTAG
AGTLKDAMNEAMRDWVANVADTYFLVGTVAGPHPYPEMVRDFQSVIGVEVKEQITQAEGR
LPDVIVAAIGGGSNAMGIFHPFLDDASVRLIGVEAAGRGLDSGKTAASISRGRPGVLHGN
RTYLLQDKHGQIEEAHSISAGLDYPGIGPEHSWLNDIGRAEYVGVTDEEALEAFQVCTRT
EGIIPALECAHGLAHVMKIAPTMAKDQIIVLNVSGRGDKDIFTVAHHLGVKL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacacaccttcccccctgtcccctcctttggccaattccctccgttccggtccg
gatgaccgggggcggttcgggattttcggtggccgcttcgttgcggaaacgctgatgccg
ctgctgctggagctggatgaggcctatcgcgccgcgcaggccgatccggaattccgcaag
gagctggactattatctgaaggattatgtcggtcgtccgagcccgctgtggtttgcgcag
catctgacggaggagcttggcggggcgaaggtctacttcaagcgtgaagagctgaaccat
accggctcgcacaagctcaacaacgtcatgggccagattctcgtcgcccggcggatgggc
aagacgcggattgtcgcggagaccggcgcggggcagcacggtgtggcgacggcgacggtc
tgtgcgctttttgggctgaaatgcacgatttacatgggcgcaaccgacgtcgagcggcag
aagcccaatgtgttccgcatgcatctactgggcgcggaagtgaagcctgtaacggccggg
gcggggacgctcaaggatgcgatgaacgaggccatgcgtgactgggtggccaatgtcgcc
gacacgtatttcctcgtcggtacggtcgcagggccgcatccgtatccggagatggttcgt
gatttccagtccgtcatcggggttgaggtcaaggagcagattacccaggccgaagggcgc
ctgccggatgtgatcgtggcggccatcggtggcgggtcgaacgcgatggggattttccac
ccgttcctcgatgatgcgtccgtcaggctgattggcgtcgaggcggcggggcgtgggctg
gattccgggaagacggcggcgtccatttcccgtgggcggccgggtgtgctccatggcaac
cggacgtatctgcttcaggataagcacgggcagatcgaggaggcgcattcgatcagcgca
gggctcgattatccggggatcgggccggagcattcctggctgaatgatatcgggcgggct
gaatatgtgggtgtgacggatgaggaggcgcttgaggcgttccaggtctgcacgcggacg
gagggcattatcccggcgctcgaatgcgcgcatgggctggcgcatgtcatgaagatcgcg
cccacgatggcgaaggaccagatcattgtcctgaatgtctccgggcgtggggacaaggac
atctttactgtggcgcatcatctgggagtgaagctgtga

DBGET integrated database retrieval system