KEGG   Gluconobacter oxydans 621H: GOX1202Help
Entry
GOX1202           CDS       T00230                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gox  Gluconobacter oxydans 621H
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gox00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GOX1202
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GOX1202
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GOX1202
Enzymes [BR:gox01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GOX1202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1313370..1314182
Genome map
AA seq 270 aa AA seqDB search
MSRIQTRFAALKKEGRGALIPYLQACDPDYDTSLELLRAMPAAGADLIEIGVPFSDPSAD
GPTIQAAALRGLKAGATLGRVLEMVRAFRETDNETPIVLMGYLNPIDSYGPAEFCFDAAQ
AGVDGIIVVDMPTEEADLLDAHAREADLDIISLVAPTTSNSRLFHVLREASGFVYYVSIT
GITGTNSASAADLEKALPRIREATSLPVAIGFGISTPEQARTASRIGDAAVVASALIKTM
ASTLENGQATERTVPAVLKQLEGLAAAVRA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgtatccagacacgttttgcggccctgaagaaggaagggcgcggcgcgctgatc
ccgtatctgcaggcctgtgacccggattatgacacgtcgctggaactgctgcgggcgatg
ccggcggccggggcggacctgatcgagatcggggtgccgttctccgatccgtccgcggat
ggaccgacgattcaggcggcagcacttcgtggcctcaaggccggggcgacgctggggcgt
gtgctggagatggtccgggcgttccgcgagaccgacaatgaaacgccgatcgtgctgatg
gggtatctgaacccgatcgacagctatggtccggccgagttctgctttgatgcggctcag
gcgggtgtggatgggatcatcgtcgtcgacatgccgaccgaagaagcggatctgctggat
gcgcatgcgcgggaagctgatctcgatatcatctcgctggtggcaccgacgacgtcgaac
tcccgtctgtttcatgtcctgcgggaggcgagcgggttcgtctattatgtgagcattacc
gggattaccgggacgaacagtgcgagtgcggcggatctggagaaggcgctgccgcggatc
cgggaggcgaccagcctgccggtggccatcgggttcggaatttccacgccggagcaggcg
cggacggcgtctcggatcggggatgcggctgttgtggcttcggccctgatcaagaccatg
gcctcaacgctggagaatggtcaggcgacggagcggaccgtaccggcagttctgaagcag
cttgaaggtctggcggccgccgtccgggcctga

DBGET integrated database retrieval system