KEGG   Gluconobacter oxydans 621H: GOX1243Help
Entry
GOX1243           CDS       T00230                                 

Definition
dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
gox  Gluconobacter oxydans 621H
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gox00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    GOX1243
Enzymes [BR:gox01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     GOX1243
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     GOX1243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1352207..1352773
Genome map
AA seq 188 aa AA seqDB search
MSRLTVYRDDAPDTILLDVTTPGEIAETLRPHNIRFDRWSAPITPAPDAPAEEVLDAYRP
YLDTLMGETGAGSADVVRINASTPNLPELRKKFLSEHTHSEDEVRFFVHGQGAFVLHIRG
RVYSVLCTQGDLISVPAGIPHWFDAGPSPDVVALRVFTDTTGWIAQYTGDDIANRFPAEV
PVEASGNS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtctgaccgtctatcgcgacgatgctcccgatacgattctgctggacgtcacc
acgcccggcgagatcgcagagaccctgcgtccccacaacatccgctttgaccgctggtcc
gcccccattacaccggcgcccgacgcgccggcggaagaggtgctggacgcctatcgtccc
tatctcgatacgctgatgggtgagacgggtgctggcagcgcagacgtggtgcggatcaac
gcgtccacgccgaaccttcccgagcttcggaaaaaattcctgtccgagcacactcacagc
gaagacgaagtccgcttcttcgtgcacgggcagggggcgttcgtcctgcatatccgcggg
cgcgtctattccgtcctgtgcacacaaggcgacctgatctccgttcccgcaggcattccg
cattggttcgacgccgggccgtcgccggatgtcgtggccctgcgcgtctttaccgatacg
accggatggatcgcgcagtataccggcgatgacattgccaaccgttttccggccgaagtg
cctgtcgaagcctccggcaactcctga

DBGET integrated database retrieval system