KEGG   Gluconobacter oxydans 621H: GOX1536Help
Entry
GOX1536           CDS       T00230                                 

Definition
bifunctional folate synthesis protein
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
gox  Gluconobacter oxydans 621H
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gox00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1686624..1687523
Genome map
AA seq 299 aa AA seqDB search
MITPALTSVFVRDLCLFGYHGVLPEETRIGQRFVVDIEIRADLSGAIAGDDYEQAVCYGT
LCDIASAIVTGPPLQLIETVAGRIAEAVLAKLERVEWVRVEVRKPSAPVPYAVSGTAVSV
EQVRVHEVAFSLGSNLGEREAVLAAAVDRLSLVDGLEIGKVSSLYDSAPWGGVEQPTFVN
ICATGRTTLEPHALLRVCKAIEADLGRVPGVRWGARAVDIDILYYGEREIRDRVLTLPHA
CLFERAFVLEPLAEIDPDHVIGGRRVRDALAVLPRSPGDVTRRAPDGTGRWGIKEPEPA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgatcactcctgccctgacctccgttttcgtgcgggatctgtgcctgtttggctatcac
ggcgtgctgccggaggagacgcggatcgggcagcgctttgtggtcgatatcgagatccgg
gccgatttgtcaggcgcgattgcgggcgatgattatgagcaggctgtctgctacgggacg
ctgtgcgatatcgcttcggctatcgtgacggggccgcctctgcagctgatcgagacagtt
gcggggcggattgccgaggcggttctggcgaagctggagcgtgtggaatgggtgcgggtc
gaggtgcgcaagccttccgcgccggtgccttatgcggtgtcggggacggcggtgtctgtg
gagcaggtgcgggtgcatgaggttgcgttctcgctggggagcaatctgggggagcgtgag
gctgttctggcggcggcggtggatcggctgtcgctggtggacgggctggagattgggaaa
gtctcgtcgctgtatgacagcgcgccctggggcggggtggagcagccgacgtttgtgaat
atctgcgctaccggccggacaacgctggagcctcacgcgcttctgcgggtctgcaaggcg
atcgaggccgatctgggtcgtgtgccgggtgtgcgctggggcgcgcgggctgttgatatc
gacattctttattatggggagcgggaaatccgggaccgggtgctgacgctgccgcatgcg
tgtctgttcgagcgggcttttgtgctcgagccccttgcagaaattgatccagatcacgtc
attggtggacgtcgcgtgcgggacgcgctagcagtcctgccgcggagcccgggggatgtg
acccggcgcgcgcctgacggcaccggccgttggggcatcaaggagcctgaacccgcatga

DBGET integrated database retrieval system