KEGG   Gluconobacter oxydans 621H: GOX1555Help
Entry
GOX1555           CDS       T00230                                 

Definition
chemotaxis protein CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
gox  Gluconobacter oxydans 621H
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:gox00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GOX1555
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    GOX1555
Enzymes [BR:gox01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     GOX1555
Two-component system [BR:gox02022]
 CheA family
  CheA-CheYBV
   GOX1555
Bacterial motility proteins [BR:gox02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    GOX1555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1701723..1702778
Genome map
AA seq 351 aa AA seqDB search
MSGARPLTVVVVDDSLTTRALIAAALRRDPRVKIVGTAGTPFEARDLIVRLNPDVLTLDF
EMPSMNGLQFLEKIMRLRPMPVVMVSGHLSSHRGLVEQSLRMGAAEWYSKTTTANGEDPF
AGLGDAIVRAAAMKQQAPVPVATDSANRTVPKIGTVVGIGASTGGVEALTDVLGHFPVAC
PPTVIVQHMPRQFSESFARRLDRIVKPEVRLAEEGDMLKPGTVYVASGGERHLRVRCGAR
SGEYVCQLVAAPPVNGHRPSVDELFYSLATTVGKNAVGVILTGMECDGAQGLLAMRHAGA
STIGQDRASSVIYGMPRAAYELGAVETQLPLSAIGPAILNLCERRSLETYP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
ttgagtggcgcaagacccctgactgtcgtggtcgtcgatgattccctgacgacccgcgcc
ctgatcgcggccgcacttcggcgggatcccagagtaaagatcgtggggactgccggaacg
ccctttgaagcgcgtgatcttatcgtgcggctgaatccggatgtgctgacgctcgatttc
gagatgccgtccatgaatggtctgcagtttcttgaaaagattatgaggttgcggccgatg
cccgtcgtgatggtgtcgggtcatctttccagtcaccggggactggttgagcagtcgctc
cggatgggagctgcggaatggtattcgaaaacgaccacggctaacggcgaggatccgttt
gcagggctgggagatgcgattgtccgggctgcggccatgaagcagcaggctcctgtgccg
gttgctacagattctgcaaacaggactgttccgaagataggcactgtcgtcgggattggg
gcatcgacagggggcgtggaagccttaacggatgttctggggcatttccccgtggcctgt
ccgccaacggttatcgtgcagcacatgccgcggcagttttcagaaagcttcgcacgtcgt
ctggaccggatcgtgaagccggaagtcaggcttgcggaagagggcgatatgctgaaaccc
ggcacggtgtatgtcgcgtctggtggagagcgccatctgcgcgtccgctgtggcgctcgg
tctggagaatatgtctgccagctggttgcggccccacccgttaacggacatcgcccttcg
gtggatgagctgttttattccctcgccaccacagtcgggaaaaatgctgtgggggtcatt
ctgacggggatggaatgtgacggggcgcagggtctgctggccatgcgtcatgccggcgcc
tccacaatcggtcaggaccgggcgagttccgtcatctatggcatgccccgagccgcatac
gaactgggcgctgtcgagacgcagcttccactttccgccattggcccagccattctcaat
ctttgtgaacgtcgctctctggagacatatccatga

DBGET integrated database retrieval system