KEGG   Gluconobacter oxydans 621H: GOX1681Help
Entry
GOX1681           CDS       T00230                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
gox  Gluconobacter oxydans 621H
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gox00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GOX1681
Enzymes [BR:gox01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     GOX1681
DNA repair and recombination proteins [BR:gox03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     GOX1681
    RecFOR pathway proteins
     GOX1681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1839123..1839725
Genome map
AA seq 200 aa AA seqDB search
MIGQLTGLVGQIEGERCIVDVNGVGYVVSASTRTLAVLPQPPSVARVLIETIVREDAIQL
FGFATTDERDWFRLLTTVQSVGAKVALAILSANNPGELLLAINAGDKGSLTRAAGVGPRL
ADRILSELRNKVAKMPGGGGTVSAPGIVSGPSVENDALLALAGLGFRRAEAWPVLSKVLA
ENENATLDLAIRLSLKDLAR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgatcgggcagttgaccggacttgtcgggcagatcgaaggcgagcgctgtatcgtggac
gtcaatggtgtggggtacgtggtttcggcctcgacccgcacgctggcggtactgcctcag
ccgccgtctgtggcgcgcgtattgatcgagacgatcgtgcgcgaggatgcaatccagctt
ttcggttttgcgacgacggatgaaagggactggttccggctgctgacgactgtgcagagc
gtgggcgcgaaagtggcgctggcgatcctatcggcgaacaatccgggcgagcttctgctg
gccatcaatgccggagacaagggctcgctgacccgcgcggccggtgtcgggccgcgtctg
gcggaccggatcctgagcgagttgcgcaacaaggttgcgaaaatgccgggcgggggcggg
accgtgtccgcgccggggatcgtttcggggccgagtgtcgagaatgatgcgctgctggcg
ctggcggggctcggattccgtcgggccgaagcctggcctgttctgagcaaggtgctggcc
gagaacgagaatgcgacgcttgatctggcgatccggctgagcctgaaggatctcgcgcga
tga

DBGET integrated database retrieval system