KEGG   Gluconobacter oxydans 621H: GOX1681Help
Entry
GOX1681           CDS       T00230                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
gox  Gluconobacter oxydans 621H
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gox03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1839123..1839725
Genome map
AA seq 200 aa AA seqDB search
MIGQLTGLVGQIEGERCIVDVNGVGYVVSASTRTLAVLPQPPSVARVLIETIVREDAIQL
FGFATTDERDWFRLLTTVQSVGAKVALAILSANNPGELLLAINAGDKGSLTRAAGVGPRL
ADRILSELRNKVAKMPGGGGTVSAPGIVSGPSVENDALLALAGLGFRRAEAWPVLSKVLA
ENENATLDLAIRLSLKDLAR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgatcgggcagttgaccggacttgtcgggcagatcgaaggcgagcgctgtatcgtggac
gtcaatggtgtggggtacgtggtttcggcctcgacccgcacgctggcggtactgcctcag
ccgccgtctgtggcgcgcgtattgatcgagacgatcgtgcgcgaggatgcaatccagctt
ttcggttttgcgacgacggatgaaagggactggttccggctgctgacgactgtgcagagc
gtgggcgcgaaagtggcgctggcgatcctatcggcgaacaatccgggcgagcttctgctg
gccatcaatgccggagacaagggctcgctgacccgcgcggccggtgtcgggccgcgtctg
gcggaccggatcctgagcgagttgcgcaacaaggttgcgaaaatgccgggcgggggcggg
accgtgtccgcgccggggatcgtttcggggccgagtgtcgagaatgatgcgctgctggcg
ctggcggggctcggattccgtcgggccgaagcctggcctgttctgagcaaggtgctggcc
gagaacgagaatgcgacgcttgatctggcgatccggctgagcctgaaggatctcgcgcga
tga

DBGET integrated database retrieval system