KEGG   Gluconobacter oxydans 621H: GOX1681Help
Entry
GOX1681           CDS       T00230                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
gox  Gluconobacter oxydans 621H
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gox00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GOX1681 (ruvA)
Enzymes [BR:gox01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     GOX1681 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1839123..1839725
Genome map
AA seq 200 aa AA seqDB search
MIGQLTGLVGQIEGERCIVDVNGVGYVVSASTRTLAVLPQPPSVARVLIETIVREDAIQL
FGFATTDERDWFRLLTTVQSVGAKVALAILSANNPGELLLAINAGDKGSLTRAAGVGPRL
ADRILSELRNKVAKMPGGGGTVSAPGIVSGPSVENDALLALAGLGFRRAEAWPVLSKVLA
ENENATLDLAIRLSLKDLAR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgatcgggcagttgaccggacttgtcgggcagatcgaaggcgagcgctgtatcgtggac
gtcaatggtgtggggtacgtggtttcggcctcgacccgcacgctggcggtactgcctcag
ccgccgtctgtggcgcgcgtattgatcgagacgatcgtgcgcgaggatgcaatccagctt
ttcggttttgcgacgacggatgaaagggactggttccggctgctgacgactgtgcagagc
gtgggcgcgaaagtggcgctggcgatcctatcggcgaacaatccgggcgagcttctgctg
gccatcaatgccggagacaagggctcgctgacccgcgcggccggtgtcgggccgcgtctg
gcggaccggatcctgagcgagttgcgcaacaaggttgcgaaaatgccgggcgggggcggg
accgtgtccgcgccggggatcgtttcggggccgagtgtcgagaatgatgcgctgctggcg
ctggcggggctcggattccgtcgggccgaagcctggcctgttctgagcaaggtgctggcc
gagaacgagaatgcgacgcttgatctggcgatccggctgagcctgaaggatctcgcgcga
tga

DBGET integrated database retrieval system