KEGG   Gluconobacter oxydans 621H: GOX1832Help
Entry
GOX1832           CDS       T00230                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
gox  Gluconobacter oxydans 621H
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:gox00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GOX1832
  Amino acid metabolism
   00300 Lysine biosynthesis
    GOX1832
Enzymes [BR:gox01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     GOX1832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2005538..2006743
Genome map
AA seq 401 aa AA seqDB search
MWTSGRAPRPPSTIFCATDPVTGSTFPTDPVALARDLLRCQSVTPADGGAQALLAGVLEG
MGFETFHLPFGPADVPTPNLYARLGKGHPALCFAGHTDVVPPGEGWAHDPFAAVIEGDRL
YGRGIADMKGGVACFVAAVARRLEQGPLKGSVSLLITGDEEGPAHFGTKPVIEWLAERGE
LPDFCVLGEPTNPQALGDVIKIGRRGSMNAVVTVHGTQGHVAYPHLADNPVHRLLAAFSE
LTARELDAGSEWFDPSSLQVTSIDVGNGATNIIPGSAVGRLNIRFNDLHTGAALTAWIED
VVRRHAPQADVQVSISGEAFLTQPGDAVTCLSEAVRSVTGRTPRLDTGGGTSDARFISQY
CEVAEFGLVGATMHKRDENVELGTLEDLTRIYLAFMEGYGL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgtggacgagcggacgcgctccaagacctccatcaacgatcttctgcgcgactgatcct
gtgacggggtcaacctttccgacggatcccgtggcgctggcccgggatctgctgcgctgt
cagtcggtcacgcctgccgatggaggggctcaggcgcttctggcaggtgtgctggaaggg
atggggttcgagacgttccatcttcctttcgggcctgctgacgtgccgacgcccaatctt
tatgcccggctggggaaagggcatcccgcgctctgctttgcagggcatacggatgtcgtg
ccgccgggtgaaggctgggcgcatgatccgtttgcggcggttatcgagggtgaccggctt
tatggacgcgggatcgcggacatgaagggcggggtagcctgtttcgtggcagccgttgcg
cggcgtctggaacaggggccgctgaagggttccgtctcgctgctgattacgggagacgag
gaaggtccggcgcatttcgggacgaagccggtcattgaatggctggcggaacggggtgaa
ctgccggatttctgcgttctgggcgagcctacgaatccccaggcactgggggatgtcatc
aagatcggccgtcggggcagcatgaatgctgtcgtgaccgtgcacgggacgcaggggcat
gtggcctatccgcatctggcggataatccggtccatcgtcttctggcagcgttttccgaa
ctgacggcgcgggaactggatgcggggagtgagtggttcgatccgtcgtcccttcaggtc
acgagcatcgatgtcgggaacggggcgaccaatatcattccgggaagtgctgtcggccgg
ctgaatatccggttcaatgatctgcacaccggggccgctctgacggcgtggatcgaggat
gtggtgcggcgtcacgcgcctcaggcggacgtacaggtgtccatcagcggcgaggcgttt
ctgacacaaccgggggatgcggtaacgtgtctgtccgaggctgtacgcagtgtcacggga
cggacgccccggctcgataccggtggcgggacgtcggatgcgcggtttatttcgcaatac
tgcgaggtggcggagttcggccttgtcggcgcgaccatgcacaagcgtgacgaaaacgtg
gagcttgggacgctggaggatctgacacggatttatctcgcgttcatggaaggatacggg
ctgtga

DBGET integrated database retrieval system