KEGG   Gluconobacter oxydans 621H: GOX1884Help
Entry
GOX1884           CDS       T00230                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gox  Gluconobacter oxydans 621H
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:gox00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2066239..2066886
Genome map
AA seq 215 aa AA seqDB search
MTRPEPGLSATMAEVRALGWEAVACPMLDITTFESVAPGAFRAVLVTSANALPALRDWPR
DRLVVAVGARTAARARKAGFVNVEAADGDARALAAFCRARGILGADVLLASGDGYGVDLA
RDLGVQRVEVYAACKREALPGDAAEALRGGRVDSVLLYSGKTAEAFREALGAEEVTALSA
VRALCLSEAIAARLDPQEWRAVMWPDPLEQLGPVV
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtgacccggccggagcccggactgtccgctacgatggcggaggtccgggcgcttggctgg
gaggctgtggcatgtccgatgctggacatcacgacatttgagtctgttgcgccgggcgcc
ttccgggccgtgctggtgacgagtgcgaatgcgctgcctgcgttgcgggactggcctcgg
gaccggcttgttgtggcagtcggtgcgcggacggcggctcgggcgcgcaaggccgggttc
gtgaatgtcgaggcggcggacggggatgcgcgggctctggcggcgttctgccgggcgcgg
ggcattctgggcgcggatgtgctgctggccagtggcgacggctacggcgtggatctggcg
cgggatctgggcgtgcagcgggtcgaggtttatgcggcctgcaagcgggaagccctgccg
ggtgatgcggctgaggccctgcggggcgggcgagtcgattccgtgctgctgtattcgggg
aaaacggcggaagcattcagggaagcgctgggggccgaagaggtcacggcgctgtctgcc
gtgcgggcgctctgtctgtcagaggccattgccgcgcgcctggacccgcaggaatggcgc
gcggtgatgtggcccgatccgctggagcagctcgggccagtcgtctga

DBGET integrated database retrieval system