KEGG   Gluconobacter oxydans 621H: GOX1884Help
Entry
GOX1884           CDS       T00230                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gox  Gluconobacter oxydans 621H
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gox00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GOX1884
Enzymes [BR:gox01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     GOX1884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2066239..2066886
Genome map
AA seq 215 aa AA seqDB search
MTRPEPGLSATMAEVRALGWEAVACPMLDITTFESVAPGAFRAVLVTSANALPALRDWPR
DRLVVAVGARTAARARKAGFVNVEAADGDARALAAFCRARGILGADVLLASGDGYGVDLA
RDLGVQRVEVYAACKREALPGDAAEALRGGRVDSVLLYSGKTAEAFREALGAEEVTALSA
VRALCLSEAIAARLDPQEWRAVMWPDPLEQLGPVV
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtgacccggccggagcccggactgtccgctacgatggcggaggtccgggcgcttggctgg
gaggctgtggcatgtccgatgctggacatcacgacatttgagtctgttgcgccgggcgcc
ttccgggccgtgctggtgacgagtgcgaatgcgctgcctgcgttgcgggactggcctcgg
gaccggcttgttgtggcagtcggtgcgcggacggcggctcgggcgcgcaaggccgggttc
gtgaatgtcgaggcggcggacggggatgcgcgggctctggcggcgttctgccgggcgcgg
ggcattctgggcgcggatgtgctgctggccagtggcgacggctacggcgtggatctggcg
cgggatctgggcgtgcagcgggtcgaggtttatgcggcctgcaagcgggaagccctgccg
ggtgatgcggctgaggccctgcggggcgggcgagtcgattccgtgctgctgtattcgggg
aaaacggcggaagcattcagggaagcgctgggggccgaagaggtcacggcgctgtctgcc
gtgcgggcgctctgtctgtcagaggccattgccgcgcgcctggacccgcaggaatggcgc
gcggtgatgtggcccgatccgctggagcagctcgggccagtcgtctga

DBGET integrated database retrieval system