KEGG   Gluconobacter oxydans 621H: GOX1889Help
Entry
GOX1889           CDS       T00230                                 

Definition
cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
gox  Gluconobacter oxydans 621H
Brite
Enzymes [BR:gox01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     GOX1889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2070463..2071941
Genome map
AA seq 492 aa AA seqDB search
MVRSSTITKGIAGLVALGVVAWGGTVTYLEHFDHAGAPQLPASSPTRQDPTAMAAFAALR
EVRCDYCHTQNVELPFYFKLPLANQIMKRDLVQGQRHFEYAPVLTALQDGKPPSVEQLSR
IEEVITQNRMPPSAYLLMHPHAHLDEKQRADILKWVREQRERYYATPGVAAQFRGEPIQP
IPESVDVNWKKAELGRALFFDKGLSGDGTLNCASCHGLNKGGVDNLTTATGIGGQKGPIN
VPTVYNAVFSMAQFWNGRAKDLAEQAAGPVMNPLEMGSHDWNTVADHVRSTPGYAEQFTA
AFGSEQIDKDTITAAIAEYEKTLITPDSRFDLYLKGDAKAITAPEKRGYERFKEIGCSGC
HSGLAVGGDAYEILGLEGPYFENRHTKLTDADEGRMAVTHKEGDRERFKVPNLRNVELTG
PWLHDGSATTLEQVVREMARYETPDHDIADQDVTDIVAFLKTLTGKYEGIPLKDVPADQP
LQAPVSGSGSSN
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
gtggtgcgttccagcacgattacaaagggaattgccggtctggtggcgctgggcgttgtc
gcctggggcgggaccgtcacttatcttgagcattttgatcatgctggagcaccgcagttg
cctgccagcagcccgacgcgtcaggatccgacggcgatggcggcgtttgcggcccttcgg
gaagtgcgctgcgattactgccatacgcagaatgtcgaactgccgttctatttcaagctg
ccgctggccaatcagatcatgaagcgtgatctggtgcaggggcagcgtcatttcgaatat
gcgccggttctgacggccctgcaggacggcaagccgccttccgtcgagcagctttcgcgc
atcgaggaagtcatcacgcagaaccggatgccgccgtcagcctatctgctgatgcatccg
catgcgcatctggatgaaaagcagcgcgcggacattctgaaatgggtgcgtgagcagcgt
gagcgttactatgcgacgccgggtgtggcagcgcagttccgtggtgagccgatccagccg
atccccgaaagcgtggatgtgaactggaagaaggccgagctgggccgggcgctgttcttc
gacaagggactgtctggtgatggcacgctcaactgtgcaagctgccacggtctgaacaag
ggtggcgtggacaacctgacgacggcgacggggatcggcggccagaaggggccgatcaat
gtaccgaccgtctataacgccgtgttcagcatggcgcagttctggaatggccgtgcgaag
gatctggcggagcaggcggcaggtccggtcatgaacccgctggaaatgggttcgcatgac
tggaacaccgtagccgatcatgtccgcagcacgccgggttatgccgagcagtttacggcg
gcgttcggttctgagcagatcgacaaggacacgatcacggcggcgattgcggaatatgaa
aagacgctgatcactccggacagccgctttgacctgtatctgaaaggcgatgcgaaggcg
atcacggcgccggaaaagcgcggttacgagcgcttcaaggagatcggctgctcggggtgc
catagcggtcttgccgtgggaggagacgcttatgaaatccttggtctggaagggccgtat
ttcgagaaccgtcatacgaagctgacggatgccgatgaaggccgcatggctgttacgcat
aaggaaggtgatcgtgagcggttcaaggttccgaacctgcgtaatgtcgagctgacgggg
ccgtggctgcatgatggctcggccaccacgctggagcaggtcgtgcgggagatggcacgt
tatgagacgccggatcatgacattgccgatcaggatgtcacggacatcgtggcgttcctc
aagacgctgacgggcaagtatgagggcattccgctgaaggatgtgccggctgaccagccg
ctgcaggctcctgtgtcgggttctggttcctcgaactga

DBGET integrated database retrieval system