KEGG   Gluconobacter oxydans 621H: GOX2084Help
Entry
GOX2084           CDS       T00230                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
gox  Gluconobacter oxydans 621H
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gox00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GOX2084
Enzymes [BR:gox01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     GOX2084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2286559..2287503
Genome map
AA seq 314 aa AA seqDB search
MTLRTPLILSFGSINIDLTARSQRLPRPGETVHAESYAIGLGGKGSNQAAAAARLAQAFD
VDVALAGRVGCDAFGAQARASLAGFGVDLSPLRDDADNPTGIALIGIDAAAENCITVAGG
ANMAVDETDIMAAAPWLDRAKVLLLQLEIPQSAVLAAARRTRSAGGLVVLDPAPAPEHGL
PEALWSEIDILTPNESETFSLTGIRPATVKEACRAAEILLAKGVRAVLVKMGAKGVFWHD
GTGSGHLPPFRVVPIDTVAAGDCFNAGLAVALACGESLPDAARIGSACGALATTRHGAAD
AAPGWNEVEALIRV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgcggacgcccctgatcctttccttcggcagcatcaacatcgatctgacggcc
cgcagccagcggcttccacgcccgggtgagaccgttcatgccgagagctatgcgatcggt
ctgggcggcaagggcagcaaccaggcggccgcggccgcgcgactggcgcaggcattcgac
gtggatgtcgcactggcagggcgtgtggggtgcgatgcgttcggggctcaggcccgggcc
agccttgccgggtttggggtggatctgtcacctctacgggatgatgcggacaacccgacc
gggattgccctgatcgggatcgatgcggcggccgaaaactgcatcacggtcgcgggtggg
gcgaacatggcggtggacgaaacggatatcatggctgcggccccctggctggatcgggca
aaagtcctgctgctgcagcttgaaatcccccagtctgccgttctggctgcggcgcgccgg
acccggagcgcgggtggcctcgtcgtgctggacccggctcccgcgccggagcatgggttg
cctgaagcgctgtggtccgagatcgacattctcacacccaatgaaagcgaaaccttcagc
ctgactggcatccgtcctgcaacagtgaaagaggcgtgcagggcagcggaaatcctgctg
gcgaaaggtgtccgggcggttctggtgaagatgggggcgaagggcgtgttctggcatgat
gggaccggatcaggccatctgccgccattccgggttgttccgatcgataccgtggcggcc
ggagactgcttcaacgccggtctggccgtggcgctggcctgtggggaaagcctgcccgat
gcggcacggattgggtccgcctgcggggcgctcgccacgacccgtcatggcgctgccgat
gctgctccgggatggaatgaggtcgaagctctgatccgggtttga

DBGET integrated database retrieval system