KEGG   Gluconobacter oxydans 621H: GOX2090Help
Entry
GOX2090           CDS       T00230                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gox  Gluconobacter oxydans 621H
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gox00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    GOX2090
Enzymes [BR:gox01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     GOX2090
Exosome [BR:gox04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GOX2090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2291996..2293534
Genome map
AA seq 512 aa AA seqDB search
MSKKDCILAIDQGTTSTRSIVFGKDAQALAISRREFPQHYPELGWVEHDVEDIWRDVLAT
ARETIEEVGGPERIAALGITNQRETIVIWDRETGRAIHRALVWQDRRTAHECNLLRQQGK
EAMVREKTGLLLDPYFSASKIAWLLDHVPDARRRAEAGELAAGTIDSFLLWRLTGGKRHA
TDITNACRTSLFNIHTQEWDEELLKLFNVPRALLPEVCDNSSDFGETEAKLFGEKIAIGG
MAGDQHAAVIGQACFHEGMAKATYGTGCFMLLNTGEKPIMSNNRLLTTIAYRIGGKTFYA
LEGSIFVAGAGIKWLRDGLKLITHASQTDDMATRIPDSHGVYMVPAFVGLGAPHWDPDSR
GLICGLTLGSTQAHIARAMLESVAYQTYDLIRAMREDGAMRTSILRIDGGMAVNDWFAQF
LSSMLKAEVERPVNIETTALGAAFLAGLQVGLWKSLDEVTATWKQERVFAPKMDPAQRRI
MIDGWHDAVRRTLTPSAPVAHSSVETTASQAA
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaaagactgcatcctcgccattgatcagggcacgacctcgacccgcagcatt
gtcttcggaaaagatgcgcaggctctggccatttcccgccgcgagttcccgcagcattat
cccgagctgggctgggttgagcacgatgtcgaggacatctggcgtgatgtgctcgccacc
gcgcgcgagacgatcgaggaggtcggagggccggagcgcattgcggctctgggcattacc
aaccagcgcgaaaccatcgtgatctgggaccgcgagacgggccgcgccatccatcgcgcg
ctcgtctggcaggaccgccgcacggcgcatgaatgcaacctcctgcgccagcagggcaag
gaagccatggtccgtgaaaagacgggcctgctgctggatccctatttctcggcaagcaag
atcgcctggctgctcgatcatgtccccgatgcccgtcgccgcgcggaagcgggcgaactg
gcggctggcacgatcgacagcttcctgctgtggcgtctgaccggcggcaagcgccatgcg
acggacatcaccaatgcctgccgcacctcgctcttcaacatccacacgcaggaatgggac
gaggagcttctgaagctcttcaatgtgccgcgcgcccttctgccggaagtctgcgacaac
agcagcgatttcggtgagacggaagccaagctgttcggcgagaagatcgccatcggcggc
atggcgggcgaccagcacgccgctgtcatcgggcaggcgtgcttccacgagggtatggcc
aaggcgacttacggcacgggctgcttcatgctgctcaacaccggcgagaagccgatcatg
tccaacaaccgcctgctgaccacgatcgcctatcgcatcggcggcaagactttctacgcg
ctggaaggttccatcttcgtggcgggcgccggcatcaagtggctgcgtgacgggctgaag
ctgatcacgcatgcttcccagaccgacgatatggcgacccgcatcccggacagccatggc
gtctacatggtgccggctttcgttggtcttggcgcccctcactgggacccggattcacgt
ggtctgatctgtggcctgacgcttggttccacgcaggcgcatatcgcgcgtgccatgctg
gaatccgtagcttaccagacctatgacctgatccgcgccatgcgtgaggacggggccatg
cggaccagcatcctgcgcatcgacggaggcatggccgtcaatgactggttcgcccagttc
ctgtcctccatgctcaaggctgaggtcgagcgtccggtcaatatcgagaccacggccctt
ggcgccgccttcctggcgggtttgcaggtcggactgtggaagagcctggatgaagtcacg
gccacctggaagcaggagcgtgttttcgcaccgaagatggacccggcacagcgccggatc
atgatcgatggctggcacgatgccgttcgccgcacgctgacacccagtgcgccggttgcg
cattccagcgtggaaacgacagccagtcaggcggcttga

DBGET integrated database retrieval system