KEGG   Gluconobacter oxydans 621H: GOX2217Help
Entry
GOX2217           CDS       T00230                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gox  Gluconobacter oxydans 621H
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gox00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GOX2217 (tpiA)
   01230 Biosynthesis of amino acids
    GOX2217 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GOX2217 (tpiA)
   00051 Fructose and mannose metabolism
    GOX2217 (tpiA)
   00562 Inositol phosphate metabolism
    GOX2217 (tpiA)
Enzymes [BR:gox01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GOX2217 (tpiA)
Exosome [BR:gox04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GOX2217 (tpiA)
  Exosomal proteins of bladder cancer cells
   GOX2217 (tpiA)
  Exosomal proteins of melanoma cells
   GOX2217 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2433305..2434132
Genome map
AA seq 275 aa AA seqDB search
MSIQPVGQSFGRLVVDQKNVWIGTSWKMNKGPSEAIAAARALESFQPPEGIRSFVIPSFT
SLRDVCSVLEDSALLVGAQNMHWEDSGAWTGEVSAPMIAECGASIVEIGHSERRQHFGET
DWTVNLKVQAALRHGLRPLICIGDTSDEFEFGVSQETLARQVKIALHGVSRKDLGQVMVA
YEPVWAIGSAGRPAEASFVSGIHTRLRAVVRELAGDSGVRIPLLYGGSVSQANIRDYVAL
PDVDGVFVGRAAWEPADFMRLVESVSGVVSRKIAA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagcattcagccagttggtcagtctttcgggaggttggttgtggatcagaagaacgtc
tggatcgggacgagctggaagatgaacaagggaccgtccgaagcgattgcggcggcgcgg
gcgcttgaatccttccagccgccggaagggatccggtcgttcgtgatcccgtctttcacg
tcgctgcgggatgtgtgctcggtgctggaagacagcgcgcttctggttggcgcgcagaac
atgcactgggaggacagcggcgcctggaccggggaggtttccgcgccgatgattgccgag
tgcggagcgtccatcgtggaaatcggccattcggagcgccgacagcatttcggcgagacg
gactggacggtgaacctaaaggtccaggccgcgctgcggcacggtctgcgtccgctgatc
tgcattggcgatacgtcggatgaattcgagttcggggtttcgcaggaaacgctggcacgt
caggtgaaaattgcgctgcatggggtgtccagaaaggatctggggcaggtcatggttgcg
tatgagccggtctgggccatcggatcagcgggacgtccggccgaggcgtcgttcgtgtcc
gggatccataccagattgcgtgctgtcgtgcgtgaactggcgggggacagtggcgtgcgg
attccgctgctttatggcggcagcgtctcgcaggccaatatccgcgattacgtcgcattg
ccggatgtggacggtgtgtttgtcgggcgtgcggcctgggagcctgcggatttcatgagg
ctggtggaaagtgtgagcggggttgtgtcccgaaaaattgccgcgtga

DBGET integrated database retrieval system