KEGG   Gluconobacter oxydans 621H: GOX2253Help
Entry
GOX2253           CDS       T00230                                 

Definition
oxidoreductase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
gox  Gluconobacter oxydans 621H
Brite
Enzymes [BR:gox01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     GOX2253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2469484..2470503
Genome map
AA seq 339 aa AA seqDB search
MTQGDSATMNDVTLVTGATGFVGSAVARVLEERGHRLRLLVRPTSDRSNIAELNAELAVG
DLSDPDTLAPALKGVKILFHVAADYRLWVPDPETMMKANVEGTRNLMLAALEAGVEKIIY
CSSVAALGLRSDGVPADETTPVSESQVIGIYKLSKYRAEQEVLRLIREKNLPAIIVNPST
PVGPRDIKPTPTGQMILDCASGNMPAYVETGLNIVHVDDVAEGHALALERGKIGEKYILG
GENIMLGDLFRMVSQIAGVKPPAVKLKQSWLYPVALVSEWLARGFGIEPRVTRETLAMSK
KLMFFSSDKAKKELGYAPRPARDAVTDAIAWFRQHGRMK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaggagactctgccaccatgaacgatgtcacactcgttacgggggctacgggg
tttgtcggctctgccgtcgcccgcgtccttgaagaacgcggccaccgcctgaggcttctc
gtccggccgacatccgaccgttcaaatattgctgagctgaacgcggaactcgccgtcggt
gacctttcggatcctgacacgctcgctccggcgctgaagggcgtcaaaatcctgttccac
gttgctgccgattaccgactctgggttcctgatccggaaaccatgatgaaggccaatgtg
gaaggtacccgcaacctgatgctggccgccctcgaggctggcgtggaaaaaatcatttac
tgttcgtcggttgcggccctggggctgcgaagcgacggcgtgccggcagacgaaaccacg
ccggtttccgaaagccaggtcatcgggatctacaaactttcgaaataccgcgcggaacag
gaagtcctccgcctcatccgggagaagaacctgccggcgatcatcgtgaacccctcgacg
ccagtcgggccacgagacatcaagccgacacccaccggacagatgatcctcgactgtgcc
agcggaaacatgccggcctatgtcgagaccgggctgaatatcgttcatgtcgatgacgtc
gccgaaggtcatgcccttgcgctggagcggggaaagatcggcgagaaatacattctcggc
ggtgaaaacatcatgctgggcgacctgttccgcatggtcagccagattgccggagtgaag
ccacctgccgtcaagctcaagcagtcctggctctatccggtggcgcttgtgtccgaatgg
ctggcccgcgggttcggtatcgagccgcgcgtcacgcgtgagacgctggccatgtccaag
aagctgatgttcttctcgtccgacaaggcaaagaaagaactcggatatgccccacgcccg
gcccgcgatgccgtgacagatgccattgcctggttccgtcagcacggacggatgaaataa

DBGET integrated database retrieval system