KEGG   Gluconobacter oxydans 621H: GOX2284Help
Entry
GOX2284           CDS       T00230                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gox  Gluconobacter oxydans 621H
Pathway
gox00010  Glycolysis / Gluconeogenesis
gox00051  Fructose and mannose metabolism
gox00562  Inositol phosphate metabolism
gox01100  Metabolic pathways
gox01110  Biosynthesis of secondary metabolites
gox01120  Microbial metabolism in diverse environments
gox01130  Biosynthesis of antibiotics
gox01200  Carbon metabolism
gox01230  Biosynthesis of amino acids
Module
gox_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:gox00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GOX2284
   00051 Fructose and mannose metabolism
    GOX2284
   00562 Inositol phosphate metabolism
    GOX2284
Enzymes [BR:gox01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GOX2284
Exosome [BR:gox04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GOX2284
  Exosomal proteins of bladder cancer cells
   GOX2284
  Exosomal proteins of melanoma cells
   GOX2284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM TMP-TENI
Motif
Other DBs
NCBI-ProteinID: AAW62017
UniProt: Q5FNN0
Position
complement(2501792..2502592)
Genome map
AA seq 266 aa AA seqDB search
MPPSPRLVVGNWKMHGLREQSGRLARAVAEGAQSLPDDVRLVLCPPFTQLASVHGIINAE
GPATPLRLGAQDCHTTSSGPHTGDISAEMLADLGVRYVILGHSERRQAHGETDVLIRQKV
EAAEAAGLIPIVCIGETTQERLEGRTTTVLATQVEGSLTDGFTGILAYEPVWAIGSGTIP
PIDELERTLSLLHGLLQSRLKTDDIRVPILYGGSVTPAQAPTIFSIGSLGGVLVGSASLE
AESFLRIAEAASFRLTSQPLSGPYRS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgcccccatcacccaggcttgtcgttggaaactggaagatgcacggattgcgggagcag
tccggccgtctggcccgtgccgtcgccgagggcgcgcagtcccttcccgatgacgtgcgg
ctcgtcctgtgcccacccttcacccagctcgccagcgtgcatggcatcatcaatgccgaa
gggccggccacgccgctgcgtcttggtgcgcaggactgtcatacgacgtcttcggggcct
cataccggggatatctcagctgaaatgctggccgaccttggtgtccgctacgtcattcta
ggccattccgaacgtcggcaggcccatggcgaaaccgatgtcctgattcgccagaaggtc
gaagctgccgaagctgcgggcctcattcccatcgtctgtatcggcgagacgacgcaggag
cgtctcgaagggcggacgaccaccgttctggccacgcaggtcgagggatcgttgaccgac
ggctttaccggtatcctggcttacgagcccgtctgggccatcggaagcggcacgatcccg
cccatcgacgagctcgagagaaccctctctctcctgcatggactgttgcagtcccgtctc
aagacggatgacattcgcgtgccgatcctgtatggcggctccgtcacaccggctcaggcg
ccgaccattttttccatcgggtcgcttggcggggtgctggttggcagtgccagtctggaa
gcagagagcttcctgcgcatcgctgaagcggcatctttccgcctgacgtcccaaccattg
tccggaccctatcgttcatga

DBGET integrated database retrieval system