KEGG   Gluconobacter oxydans 621H: GOX2288Help
Entry
GOX2288           CDS       T00230                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
gox  Gluconobacter oxydans 621H
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gox00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GOX2288
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GOX2288
Enzymes [BR:gox01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     GOX2288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2507882..2508808
Genome map
AA seq 308 aa AA seqDB search
MTFMYHRPAMTYSPEGTEQFPDPEIPETTTPPIKDPEAETAADRSDVLARICARTRVDIE
QRSQIMSLKEITARAREVTVPTRGFGQALQHLTADRQVGLIAEIKKASPSAGILRPDYNP
VEIAQEYQAAGATCLSVLTEGSCFHGSTDDIRAVREACSLPILRKDFILDPWQVHESRLI
GADCILLIMAILTETQAAELIAIARGLDMDVLLEVHDEAELNRALALDTFLIGINNRNLR
TLKTDIQTTIDLAPLVPPDRLVVSESGIRTQDDMMKVGAVGASAVLVGESLLREPDPGVA
ARRLLGFV
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgacattcatgtaccatcgaccggcgatgacatattcgcctgagggaacggaacagttc
ccggacccggaaattccggaaacgacgaccccgcccatcaaggaccccgaagcggaaact
gctgccgaccgcagcgacgttctggcccggatctgtgcccgcacccgcgtggatatcgaa
caacgctcgcagatcatgtccctcaaggagatcacggcgcgcgcccgggaagtcacggtc
ccgacacggggcttcgggcaggcactccagcatctcacggccgatcgtcaggtcgggctg
attgccgagatcaagaaggcgtctccgtctgccggtatcctgcgtccggactacaatccg
gtcgagatcgcacaggaataccaagctgccggcgccacctgtctttcggtactgacggaa
ggctcgtgctttcacggcagcacggacgatatccgggccgtgcgcgaagcatgcagcctg
ccgatcctgcgcaaggacttcattctggacccctggcaggttcatgagagccgcctgatc
ggggcggactgcatcctgctgatcatggcgatcctgacagaaacccaggctgccgaactg
atcgcgattgcacgcgggctggacatggatgtcctgctggaagtccatgacgaggcggaa
ctgaaccgggcgctggcactggatacgttcctgatcgggatcaacaaccgtaacctgcgg
acactgaagaccgacatccagacgacgatcgaccttgcaccgctggtgccgcctgatcgt
ctggtcgtctccgaaagcggcatccggacgcaggacgacatgatgaaggtcggggcagtc
ggagcaagcgcggttctggttggcgagagcctgctgcgtgagcccgaccccggcgtggcc
gcacgccgtctgctcggtttcgtatga

DBGET integrated database retrieval system