KEGG   Gluconobacter oxydans 621H: GOX2291Help
Entry
GOX2291           CDS       T00230                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gox  Gluconobacter oxydans 621H
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:gox01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gox00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:gox00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:gox00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2511361..2512572
Genome map
AA seq 403 aa AA seqDB search
MPALSPTMTEGKLARWLKAEGDTVSAGDVIAEIETDKATMEVEAVDEGILSRILIQEGVE
GIPVNTPIAVLVEDGEAVPEASSTQAPAAPKAEAAPAVLTGTAPAKAAPEEKGERIFVSP
LARRMARERGIALDALTGSGPNGRILKRDVEKGVTAPKTSPKAAPSAAPLAASEETVRHV
PNSTMRKVIARRLTESKTQVPHFYVSVDIELDALLDLRAKLNATAQENSFKISVNDMMIK
AVALALKKVPGVNVQFTDAETLHFENVDISMAVSVPDGLITPIIRNADRKSLRQISVEAK
DLAKRARAGKLKPEEFQGGTFSISNMGMFGVREFAAIINPPQAGILAIASGEKRAVVRGS
EIAVATVMTATLSVDHRAVDGALGAEWLNALRDIVQNPYTLVV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgctgtcgccgaccatgaccgagggcaaactggcccgctggctcaaagccgag
ggcgataccgtctccgctggcgacgtaattgccgagatcgaaaccgacaaggcgaccatg
gaagtggaagccgtggacgagggcatccttagccgcatcctgatccaggaaggcgtcgag
ggtattcccgtcaacacgccgatcgcggttcttgtggaagacggtgaggctgtgccggaa
gcctcttccacgcaggccccagcggccccgaaagcggaggccgctccggctgtattgacg
ggaacagcgcctgcaaaagcggcgccagaagagaagggcgagcggattttcgtctctccg
ctggcgcgccgcatggcacgtgaacggggcattgcccttgatgcgctgacgggaagcgga
ccgaacggccgtattctcaagcgcgatgtggaaaagggtgtgacggctccgaagacttcg
ccgaaagcagctccgtcagcggcacctcttgccgcttcggaagagacggtgcgtcacgtt
ccgaactccacgatgcgcaaggtcattgcgcggcgtctgacggagtccaagacgcaggtt
ccgcatttctatgtctcggttgatatcgagctggatgcgctgctggacctgcgtgcgaag
ctgaatgccaccgcgcaggaaaacagcttcaagatttccgtcaacgacatgatgatcaag
gccgttgcactggcgctgaagaaagtgccgggtgtaaacgtgcagttcacggatgccgag
acgctgcatttcgaaaatgtggacatctcgatggccgtgtcggtgccggacggtctgatc
acgccgatcatccgcaacgccgatcgcaagtccctgcgccagatcagcgtcgaagccaag
gatctggccaagcgcgcccgtgctggaaagctcaagcccgaggaattccagggcggcacg
ttctccatttccaacatgggcatgttcggcgtgcgcgagttcgcggcgatcatcaatccg
ccgcaggccggtatcctggcgattgcctcgggtgagaagagggccgtggtacgtggatca
gaaattgctgttgcaaccgtgatgacggcgacgctttcggtcgatcaccgtgccgtcgat
ggcgcgcttggtgccgaatggcttaatgcactgcgcgatatcgtgcagaacccttacact
ctggtggtctga

DBGET integrated database retrieval system