KEGG   Gluconobacter oxydans 621H: GOX2419Help
Entry
GOX2419           CDS       T00230                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
gox  Gluconobacter oxydans 621H
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gox00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GOX2419
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GOX2419
   00052 Galactose metabolism
    GOX2419
   00500 Starch and sucrose metabolism
    GOX2419
   00520 Amino sugar and nucleotide sugar metabolism
    GOX2419
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GOX2419
   00524 Butirosin and neomycin biosynthesis
    GOX2419
Enzymes [BR:gox01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GOX2419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2630053..2631021
Genome map
AA seq 322 aa AA seqDB search
MREIVAVDIGGTHARFAIATIEDGKVVSLGEATTLKCAEHGSLALAWETFGRSLNRTLPR
EAGIAVACPVSGEILKLTNNPWIIQPSQLGARLHLDNFVLVNDFGAVAHAVAQVDSSHMK
HLCGPDIDLPTEGAITIVGPGTGLGAACLLRRSDRYFVMETEGGHLDYPPLDELEDKILS
ALRLRFRRVSAERIVSGPGLTNLYEVIAEMQGWPITLRDNRTLWKNALDGSDTVAVAALE
RFCLSLGAISGDLALAHGARGVVIGGGLGLRLADSLGHSGFAERFVAKGRFEAMMTEMPV
KIITHPQPGLFGAAAAYAEAHP
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagggaaatcgtagccgtcgatatcggtggaacgcacgcacggtttgcaatcgcgacc
atcgaggatggcaaggtcgtctcactgggtgaggccacgacgctgaaatgcgcggaacat
ggcagtctggccttggcctgggaaacattcggccgttccctgaaccggacgcttccacgc
gaagccggcattgccgtagcctgtccggtaagcggcgagatcctcaagctgaccaacaat
ccttggatcatccagccgagccagctcggcgcgcgcctgcatctcgacaatttcgtactc
gtcaacgatttcggagccgtggctcacgccgtagcccaggtcgattcctcgcacatgaaa
catctctgcggaccggacatcgaccttccgacggaaggcgccatcacgatcgtcggcccg
ggcacaggactgggtgcagcctgcctgcttcgccgcagtgaccgctattttgtcatggaa
accgaaggcggccatctggactatccgccgctcgacgaactcgaagacaagatcctcagc
gccctgcgtctgcgttttcgccgcgtctctgccgagcggatcgtctccggaccgggcctg
accaatctgtacgaagtcattgccgagatgcagggctggcccatcaccctgcgtgataac
cgcaccttgtggaaaaacgccctcgatggctccgatacggtcgccgtggctgccctggaa
cgcttctgcctcagcctgggcgccatttccggcgatctggcgctggcacatggcgcacgc
ggcgtcgtcatcggtggtggtctgggactgcgtctcgccgacagcctcggccattccgga
ttcgccgaacgcttcgtcgcaaagggccgcttcgaggcgatgatgaccgaaatgccggtc
aagatcatcacacatccacagcccggcctgttcggcgctgcggcagcatacgcggaagcg
catccgtaa

DBGET integrated database retrieval system