KEGG   Gluconobacter oxydans 621H: GOX2419Help
Entry
GOX2419           CDS       T00230                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
gox  Gluconobacter oxydans 621H
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:gox01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gox00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:gox00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gox00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:gox00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:gox00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2630053..2631021
Genome map
AA seq 322 aa AA seqDB search
MREIVAVDIGGTHARFAIATIEDGKVVSLGEATTLKCAEHGSLALAWETFGRSLNRTLPR
EAGIAVACPVSGEILKLTNNPWIIQPSQLGARLHLDNFVLVNDFGAVAHAVAQVDSSHMK
HLCGPDIDLPTEGAITIVGPGTGLGAACLLRRSDRYFVMETEGGHLDYPPLDELEDKILS
ALRLRFRRVSAERIVSGPGLTNLYEVIAEMQGWPITLRDNRTLWKNALDGSDTVAVAALE
RFCLSLGAISGDLALAHGARGVVIGGGLGLRLADSLGHSGFAERFVAKGRFEAMMTEMPV
KIITHPQPGLFGAAAAYAEAHP
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagggaaatcgtagccgtcgatatcggtggaacgcacgcacggtttgcaatcgcgacc
atcgaggatggcaaggtcgtctcactgggtgaggccacgacgctgaaatgcgcggaacat
ggcagtctggccttggcctgggaaacattcggccgttccctgaaccggacgcttccacgc
gaagccggcattgccgtagcctgtccggtaagcggcgagatcctcaagctgaccaacaat
ccttggatcatccagccgagccagctcggcgcgcgcctgcatctcgacaatttcgtactc
gtcaacgatttcggagccgtggctcacgccgtagcccaggtcgattcctcgcacatgaaa
catctctgcggaccggacatcgaccttccgacggaaggcgccatcacgatcgtcggcccg
ggcacaggactgggtgcagcctgcctgcttcgccgcagtgaccgctattttgtcatggaa
accgaaggcggccatctggactatccgccgctcgacgaactcgaagacaagatcctcagc
gccctgcgtctgcgttttcgccgcgtctctgccgagcggatcgtctccggaccgggcctg
accaatctgtacgaagtcattgccgagatgcagggctggcccatcaccctgcgtgataac
cgcaccttgtggaaaaacgccctcgatggctccgatacggtcgccgtggctgccctggaa
cgcttctgcctcagcctgggcgccatttccggcgatctggcgctggcacatggcgcacgc
ggcgtcgtcatcggtggtggtctgggactgcgtctcgccgacagcctcggccattccgga
ttcgccgaacgcttcgtcgcaaagggccgcttcgaggcgatgatgaccgaaatgccggtc
aagatcatcacacatccacagcccggcctgttcggcgctgcggcagcatacgcggaagcg
catccgtaa

DBGET integrated database retrieval system