KEGG   Gluconobacter oxydans 621H: GOX2567Help
Entry
GOX2567           CDS       T00230                                 

Definition
putative type I restriction enzyme
Orthology
K01153  
type I restriction enzyme, R subunit [EC:3.1.21.3]
Organism
gox  Gluconobacter oxydans 621H
Brite
Enzymes [BR:gox01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     GOX2567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pGOX1:complement(63101..66397)
Genome map
AA seq 1098 aa AA seqDB search
MVSAPKFQEEYSAKLPALALLSTLGWRFLPLSEALALRGGKQDAVVLAPLLRAELKKRRF
TFEGQEHSLSDQAIDALVSHVTHPDFVSGLRDANDKMTTHLLFGIAITQFINGRKANPTI
ALIDWQNPQNNSFTFTEEYSVLRTDLTQTRRPDIVCFVNGIPLAVIEAKRPDGQPGKGPT
VDAGISQSIRNQNKDEIPQLFAYSQLLLSITGHDGRYGTCGTPKKFWASWKEEDIPESRM
ETLKNTPLSGAQKDALFADRKPPARIWFEDWASRPLHVTDQDRLLIGLLSPQRLLDMARF
FTLVDRKAGKIVARYQQVFGIKRLLERIKSRRSDGGREGGVVWHTTGSGKSFTMVFLSRA
LILDDDLKQCRIIVVTDRKDLERQLSTTFSTGGELADKKDKEEALATSGRRLAQQIGHGQ
ERIIFSLINKFHTATALPECHNDSADIIVLVDEGHRSQGGENHARMKHALPNAAFIAFTG
TPLLKGSETTSRFGKIIHSYTMQQAVSDGTVTPLLYEERKPDLDVNDRAIDAWFERITQG
LTEEQVTDLKKRFARANQVYKADDRIRLIAMDLATHFDSNIDSGLKGMLACDSKLSAIRY
KQYLDEVGLFESAIVMSPPDTREGHTEVDERKQPEIQDWWKNNVGSQSEDDYTRGVIERF
EKDPDLRLIIVVDKLLTGFDEPKNAVLYIDKPLKQHNLLQAIARVNRLHDQKKHGLLIDY
RGILAELDTTLARYDELAAENVGGYDPKDITGLYSQMSTEYRELPALHKALWAIFEGVKN
RSDLQQLRAVLMPRMVEEHGQMVDVNLKRRDDFYEALTKFAACLKVALQSVAFFEDTSFT
EQDRATYKETLKQMTSLRQMVMQDTGETVDFDQYAEQVKKLLDRHVAGVKVHESGGLYAV
GKMGQKPEDNEPETWSEEKTRNETDLIRTRVTKMIEHEMQDDPYAKEAFSALLRRVIEEA
ESLFDHPLKQFMLFQEFEEQVANRKLDNIPSVFDGHRHAQAYYGVLLKTLAAIFNHKQTD
EENQRWIDLAFKIDTVVDKAVRENSLSRPDMEKAVRKELLPLLFSTGQKAGFGVDKAQEI
IEQVIQIMRAGPADTLRG
NT seq 3297 nt NT seq  +upstreamnt  +downstreamnt
atggtttctgccccgaaatttcaggaagaatacagcgccaagcttccggccttggcgtta
ctcagcacgctcggctggcggtttctgcccctatccgaggcgctggccctgcggggtggc
aagcaggacgctgtggtgctcgccccccttctgcgggcggaactgaaaaagcggcgcttt
acgtttgaaggacaggagcacagcctgtctgatcaggccattgatgcgctggtctcccac
gtcacgcatccggatttcgtctccggcctgcgcgatgccaatgacaagatgacgacgcat
ctgctgttcggcattgccattacccagtttatcaacggccgcaaggccaacccgaccatc
gccctcatcgactggcagaacccgcagaacaacagctttaccttcactgaagaatacagc
gttctgcgtacggatctgacgcagacccgcaggccggacatcgtctgcttcgtcaacggt
attccattggccgtcatcgaggccaagcgccccgatggtcagccgggcaaaggcccgacc
gtggacgccgggatttcccagagtattcgcaaccagaacaaggacgaaattccgcagctt
tttgcctacagccagcttctgctgtccatcaccgggcatgacggacgctatggcacctgc
ggcacacccaaaaaattctgggcaagctggaaggaagaggacattcccgaaagccggatg
gagacgctcaagaacacgccgctttcgggtgcgcaaaaagacgcgctgtttgccgatcga
aagcccccggcccggatatggttcgaggactgggcctcccgcccgctgcatgtcacggat
caggatcggctgctgatcggcctgctctcgccccagcgcctgctggacatggcgcggttc
tttacgctggtcgaccgcaaggcgggcaagatcgtcgcccgctatcagcaggtctttggg
atcaaacgcctcttggagcgcatcaagtcccgccgcagcgatggcgggcgtgagggcggc
gtggtctggcacaccacggggtctggcaagtcctttaccatggtgttcctcagccgcgcc
ctcattctggatgatgatctcaagcaatgtcgcatcattgtcgtgacagaccgcaaggat
ctggaacgccagttgagcaccaccttctccacaggaggtgaactggcggacaagaaggac
aaggaagaggcactcgccacctctggccgccgtctggcgcagcagatcgggcatggacag
gaacgcatcatcttctcgctcatcaacaagttccacaccgccaccgctctgcccgaatgc
cataatgacagtgcggacatcatcgtgctggtggatgaaggccatcgcagtcagggcggt
gagaaccatgcccgcatgaagcacgccttgcccaacgccgccttcattgcctttaccggt
acgccgctactcaaggggagtgagaccaccagccggttcggcaaaatcatccactcctac
acgatgcagcaggctgtctcggacggaaccgtgacgcccctgctctatgaggaacgcaag
cccgatctggatgtgaacgaccgagccattgatgcctggtttgagcgcatcacacagggg
ctgaccgaggagcaggtcacggacctcaagaagcgctttgcccgcgccaatcaggtgtat
aaggccgatgatcgcatccggctgatcgccatggatctggccacgcatttcgacagcaat
atcgacagcgggctgaaggggatgctggcctgtgacagcaagctctccgccattcgctac
aagcagtatctggatgaggtcggtctgttcgagagcgccatcgtcatgagcccgcccgat
acgcgcgaaggccatacggaagtggatgagcgcaaacagcccgagattcaggactggtgg
aagaacaatgtcggcagccagagcgaagatgactacacacgcggcgtcattgaacgcttc
gaaaaagacccggacctcaggctgattatcgtggtcgacaagctgctgaccggctttgat
gaaccgaagaacgcggtgctgtatatcgacaagccgctgaagcagcacaacctgcttcag
gccattgcccgcgtgaaccgcctgcatgaccagaagaagcatgggctactgattgattat
cgcggcattctggcggagctggacaccacgcttgcccgctatgacgaactggcggccgaa
aatgttggcggatatgacccgaaggacattaccgggctgtatagccagatgagcacggaa
taccgcgaactcccggccctgcacaaagcgctctgggccatttttgagggcgtgaagaac
agaagcgacctccagcaacttcgcgccgtgctcatgccgcgcatggtggaagaacacggc
cagatggtggacgtgaacctcaagcgccgggatgatttctatgaagcgctgacgaagttt
gccgcctgcctgaaagtagccctgcaatccgtggcgttctttgaagacaccagttttacg
gaacaggaccgcgccacctacaaggagacgctgaagcagatgaccagcctgcggcagatg
gtcatgcaggataccggtgaaaccgtggacttcgaccaatatgccgagcaggtcaaaaag
cttctggaccgacacgtcgccggtgtgaaggttcatgagtctggcggcctgtatgcggtc
ggcaagatggggcagaagccggaagacaacgaaccggaaacctggagcgaggagaaaacc
cgcaacgagacggatctgatccgcacccgtgtgacgaagatgatcgagcacgagatgcag
gatgatccgtatgcgaaggaagccttctcggccctgctgcgcagggtgatcgaggaggcg
gagagtctgtttgaccatccgctcaagcagttcatgctgttccaggagtttgaggaacag
gtggccaaccgcaagctagacaatatcccgtctgtttttgacgggcaccgccatgcgcag
gcctattatggcgtgctcctgaaaacactcgcggccatctttaaccataagcagacggat
gaggagaaccagcgctggattgatctggcgttcaagattgatacagtcgtcgacaaggcg
gtgcgggagaactcgctcagccgtcctgatatggaaaaggcagtcaggaaagaactgctg
ccgctgctgttcagcacaggccagaaagcgggctttggcgtggacaaggcgcaggagatt
atcgagcaggtcattcagatcatgcgggctggtcctgctgataccctgcgcggctga

DBGET integrated database retrieval system