KEGG   Gordonibacter pamelaeae: GPA_00590Help
Entry
GPA_00590         CDS       T02609                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
gpa  Gordonibacter pamelaeae
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gpa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GPA_00590
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GPA_00590
Enzymes [BR:gpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     GPA_00590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
55699..56835
Genome map
AA seq 378 aa AA seqDB search
MRAEEGGRGKRLVIKIGSSTLTTSESKIDYGYLAAVAAQIAEAKEAGWHPVVVTSAAIAC
GLERLGIEKRPHDMPSLQAAASVGQSALSTAYAEAFAAHGIVTSTVLLTRRDTADRQAYL
HARDTFDRLLDLGVVPIVNENDTVSVEQIRFGDNDTLAALVACLVEADLMVILSDIEGLF
DANPHFNPEAKLIGRVEAIGPEIMAVAGGAGTTVGSGGMITKIKAARVLMVAGIPMVVCN
GRRPGAIVAAARGEDVGTRFVAASKPHEITPKKLWIALGDAARGALVVDEGAKAALVSRG
SSLLSVGVSAVEGRFEAGDVVDIKDGSGHLFARGKAAFSCDEAALAIGRTRAELQANRLL
ASLADKPLVHRDELIVFE
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgagggctgaagagggcgggcgtggaaagcgcctggtcatcaagataggctcatcgacg
ctcaccacgtcggagagcaagatcgactacggctacctggccgcggtggccgcgcagata
gccgaggccaaggaggcgggatggcatccggtcgtggtcacgtcggcggccatcgcctgc
ggcctcgagcggctcggcatagagaagcgcccgcacgacatgccgagcttgcaggcggcg
gcgtcggtggggcagagcgcgctctcgacggcctacgccgaggcgttcgccgcccacggc
atcgtgacctccacggtgctgctcacgcgccgcgacacggccgaccgccaggcgtacctg
catgcgcgcgacacgttcgaccggctgctcgacctgggcgtcgttcccatcgtgaacgag
aacgacaccgtgtcagtggagcagatccgcttcggcgacaacgacacgctcgcggcgctc
gtcgcatgcctggtggaagccgatctcatggtcatcctctcggacatagaggggctcttc
gacgcgaacccgcacttcaaccccgaggcgaagctgatcggccgcgtggaggccatcggc
ccggagatcatggccgtggcaggcggggcgggcaccaccgtgggctcgggcggcatgatc
acgaagatcaaggccgcgcgcgtgctcatggtggcgggcatccccatggtcgtgtgcaac
gggcggcgccccggagccatcgtggccgccgcgcgcggcgaggacgtgggcacccgcttc
gtcgccgcaagcaagccccacgagattacgccgaagaagctttggatcgccctcggcgac
gcggcgcgcggcgcgctcgtggtcgacgaaggcgcgaaggcggcgctcgtcagccggggg
agctcgcttctgtcggtgggcgtgagcgcggtggaaggccgcttcgaggcgggcgacgtc
gtggacatcaaggacggctcggggcacctgttcgcccgcggcaaggcggcgttctcgtgc
gacgaggccgcgctcgccatcggccgcacgcgcgccgagctgcaggccaaccgcctgctc
gcgagcctggccgacaagccgctcgtccatcgcgacgagctgatcgtgttcgagtag

DBGET integrated database retrieval system