KEGG   Gamma proteobacterium HdN1: HDN1F_01010Help
Entry
HDN1F_01010       CDS       T01300                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HDN1F_01010 (hemD)
Enzymes [BR:gpb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HDN1F_01010 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
141538..142365
Genome map
AA seq 275 aa AA seqDB search
MSSDPLNGLQVLVTRPQPHGERLAARVQAAGGEAFVYPVIDIVPRELTPTEQNCIAELDR
YSGVISVSVAASELGVEACEARWPQWPLDQTWYTVGPASGKPLEGRGLNLHIAVAGSSSE
TLLALPEFQADHVAGQRFLILRGKGGRELLANTLRERGAQVDFVELYTRPPAANDPACLQ
RFLTSSAPRVALITNGESLQQLLLQAGEGRERLLQCPVIVVSGRLADYAMQQGFTEVHTA
SGAHDDALLASLCSFADAAQISPQHPSQPHFSSKT
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagctccgacccgcttaacggattgcaggtactggtaacccgcccgcagccacacggt
gagcgccttgcagcacgggtgcaggccgcgggtggggaagcgtttgtttaccctgtgatc
gacattgtgccgcgcgaacttacgccgacggaacaaaactgcattgccgaactggatcgc
tacagcggtgtaatctcggtatcggttgccgcctcggagcttggtgttgaagcctgcgaa
gcgcgctggccgcagtggccgcttgatcaaacttggtacaccgtaggccctgcgagcggc
aaaccgctggaaggccgtgggcttaatctgcatattgcggtggcaggaagcagcagtgaa
accttgcttgctttgccggaatttcaggccgatcacgtagcgggccagcggtttttgatc
ctgcgcggcaaaggcgggcgcgaattgcttgccaacaccttgcgtgaacgcggtgcgcag
gtggattttgtcgaactctacactcgcccacctgcagcgaacgatccggcatgcctgcaa
cgctttttgacgagctccgcgccacgagtggcattgatcaccaatggcgagagtctgcaa
cagctgttgctgcaagcaggggaagggcgcgagcgcttgctgcaatgcccagtgatcgtt
gtcagtggccgcctcgcagactacgccatgcagcaaggctttaccgaagtacataccgcg
agcggcgcgcatgatgatgcgctgctcgccagcttatgctcattcgcggatgccgcgcag
atttctccgcagcatccttcccaaccgcatttttcttccaagacctag

DBGET integrated database retrieval system