KEGG   Gamma proteobacterium HdN1: HDN1F_02960Help
Entry
HDN1F_02960       CDS       T01300                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:gpb01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
385207..385818
Genome map
AA seq 203 aa AA seqDB search
MLAPVVQAVPAEDQKPFRVMVLGDSLSAAYGISPKQGWVTLLAERLRQEAYSAEVVNAAI
SGNTTAAGRSRLAGALAEHQPNLVLLELGGNDGLQVLPLQAMRKNLETMIDEIRESGADV
VLLGIRIPPNYGQRYTHAFERVFKEVAEEKKTPFLPFLLEGVVEHSGWMQDDGIHPTAAA
QPAILENVWPVLKPLLPAGKKRE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcccccgttgtgcaggcagtgccggcggaggatcaaaagccgtttcgggtcatg
gtgttaggcgatagcctaagtgcagcctatggaatttcaccaaagcagggttgggttacg
cttttagccgagcgtttgcgccaagaagcctattcagcagaggttgtgaacgcggcgatc
agcggtaacactacagctgcggggcgaagccggctggcaggcgcactggcagagcaccag
ccgaatctggtgcttttggagttgggaggaaacgatggtttgcaagtgctccccctgcag
gcaatgcggaagaaccttgaaacgatgattgatgagattcgtgagagtggcgccgatgtg
gtgttgcttggtatccgtattccacccaattatggtcagcgttatacgcatgcgtttgaa
cgcgtgtttaaggaagttgcagaggaaaagaaaacgcctttcctgccgtttttgctagaa
ggtgtggtagagcattccggctggatgcaagacgacggtattcaccctaccgctgccgcg
cagcccgcgatcctagagaatgtctggccggtattgaagcctttgttgccggcgggcaaa
aagcgtgagtaa

DBGET integrated database retrieval system