KEGG   Gamma proteobacterium HdN1: HDN1F_02960Help
Entry
HDN1F_02960       CDS       T01300                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    HDN1F_02960
Enzymes [BR:gpb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     HDN1F_02960
   3.1.2  Thioester hydrolases
    3.1.2.-  
     HDN1F_02960
Lipid biosynthesis proteins [BR:gpb01004]
 Fatty acid synthase
  Component type
   HDN1F_02960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
385207..385818
Genome map
AA seq 203 aa AA seqDB search
MLAPVVQAVPAEDQKPFRVMVLGDSLSAAYGISPKQGWVTLLAERLRQEAYSAEVVNAAI
SGNTTAAGRSRLAGALAEHQPNLVLLELGGNDGLQVLPLQAMRKNLETMIDEIRESGADV
VLLGIRIPPNYGQRYTHAFERVFKEVAEEKKTPFLPFLLEGVVEHSGWMQDDGIHPTAAA
QPAILENVWPVLKPLLPAGKKRE
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcccccgttgtgcaggcagtgccggcggaggatcaaaagccgtttcgggtcatg
gtgttaggcgatagcctaagtgcagcctatggaatttcaccaaagcagggttgggttacg
cttttagccgagcgtttgcgccaagaagcctattcagcagaggttgtgaacgcggcgatc
agcggtaacactacagctgcggggcgaagccggctggcaggcgcactggcagagcaccag
ccgaatctggtgcttttggagttgggaggaaacgatggtttgcaagtgctccccctgcag
gcaatgcggaagaaccttgaaacgatgattgatgagattcgtgagagtggcgccgatgtg
gtgttgcttggtatccgtattccacccaattatggtcagcgttatacgcatgcgtttgaa
cgcgtgtttaaggaagttgcagaggaaaagaaaacgcctttcctgccgtttttgctagaa
ggtgtggtagagcattccggctggatgcaagacgacggtattcaccctaccgctgccgcg
cagcccgcgatcctagagaatgtctggccggtattgaagcctttgttgccggcgggcaaa
aagcgtgagtaa

DBGET integrated database retrieval system