KEGG   Gamma proteobacterium HdN1: HDN1F_04320Help
Entry
HDN1F_04320       CDS       T01300                                 

Definition
short chain dehydrogenase/reductase family oxidoreductase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HDN1F_04320
   00670 One carbon pool by folate
    HDN1F_04320
Enzymes [BR:gpb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     HDN1F_04320
    1.5.1.-  
     HDN1F_04320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
530856..531611
Genome map
AA seq 251 aa AA seqDB search
MSAATSLESIAPADPARFALITGAGRRLGATLCRYWLAQGWQVIGHYRTETAEVSALRAL
GATMLQADFERPDEVAGMVEQLTTQLPWLDLIVHNASSFSPDVDDLERNLAAMDGFFQVH
MKAPYAINLGLHDLLLATPRTSADIIHITDIFADRPDARYAAYCASKAGLANLSLSFAKR
FAPKIKVNAIQPGPIKFLDSHADENRVAILRETLLGREGGFEPVVQMIAALVANPFVTGA
AYKVDGGRSLS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgcaacatcgcttgaatccattgcgccggcggatccggctcgctttgcgctg
attacgggagctgggcggcggcttggcgctacgctgtgccgttattggctcgctcagggg
tggcaggtaattggccactatcgcacagaaacggcggaggtgagtgctcttcgagccttg
ggcgcgaccatgttgcaagccgattttgaaaggccagatgaggttgcaggcatggtggaa
cagcttactacgcagctgccttggctggatctgattgtgcataatgcgtctagcttttcc
cctgatgttgatgatctggaacgcaatcttgcggcaatggacggttttttccaggtacac
atgaaggctccctatgcaatcaatctggggctgcacgatttgctcttggctacgccacgc
actagcgccgatattattcatatcacagatatttttgcagaccgccctgatgcgcgttat
gcagcctattgtgcgagcaaagcgggcttggcgaatctatcactctcttttgccaagcgg
tttgcacctaagatcaaggtaaatgcgattcagccggggccgatcaagtttttagatagc
catgccgatgaaaaccgcgtggccattttgcgcgaaacgctgttggggcgagaaggaggt
tttgagcccgtcgtgcagatgatcgctgctttggtggccaatccattcgttaccggcgcg
gcttataaagtagatggagggcgctcgctctcttag

DBGET integrated database retrieval system