KEGG   Gamma proteobacterium HdN1: HDN1F_05220Help
Entry
HDN1F_05220       CDS       T01300                                 

Gene name
manB
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HDN1F_05220 (manB)
   00030 Pentose phosphate pathway
    HDN1F_05220 (manB)
   00051 Fructose and mannose metabolism
    HDN1F_05220 (manB)
   00052 Galactose metabolism
    HDN1F_05220 (manB)
   00500 Starch and sucrose metabolism
    HDN1F_05220 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    HDN1F_05220 (manB)
  Nucleotide metabolism
   00230 Purine metabolism
    HDN1F_05220 (manB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HDN1F_05220 (manB)
Enzymes [BR:gpb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HDN1F_05220 (manB)
    5.4.2.8  phosphomannomutase
     HDN1F_05220 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(636921..639623)
Genome map
AA seq 900 aa AA seqDB search
MFQFGKKGKGPAENEQNDKLPSSQTDAPSAEKSKPKREGNSLGGLAVGFLPAIAGSAVAV
GIVGALLYLQLTANLSASAMTKMVNADGQQLVQAVVHQMDALQQNLNVLAREQQTVQAIQ
GSTPEAQEALEENYRAALGTATVVRITPLREGRKDRKTTPPISFAQLEMMKAAESGKAPA
PEIHRDKEQLYISLAVPVSNDGQVVGTIYAAFDFAPIRKQLTALPENIGFFEWQQTFPGS
PPLALVASGDTQAKTGAPIQLNWGVSHWGIQAWPAAHGGLLDSIGQSVLIGFGIAALLVA
ALGGVSLFLVNRQLRNNATLFSGQLQAILSRSKSNPRYSIPLFESLAQRVDRLFYEYDAQ
LRRHAAPAASTSAAGATASFAADDDPLDIHLHEDDQDLLGATPIANPSAPLTSKLPSDDA
LDLDDLELSDEPFSTPSMPAADIGPIAPEIFRAYDIRGVVNQELTPAVACAIGGAIGAMA
KLAGQSKIVVARDGRLSSEALTQGLIEGLIGAGLRVVDIGMVPTPVLYYATQTLDTQSGV
VVTGSHNPPEYNGFKVVIAGVALAGSQIQELRKHIEAGVPTNMSGTYERYEILKAYRNRI
TNDVVLAKPMRIVLDCGNGVAGVVAPEILDRIGCTVTTLFGEVDGNFPNHHPDPSIEENL
AALIAKVRETGADLGVALDGDGDRIGIVTKQGQIIWPDRLLMLFARDLLSRNPGADVVYD
VKCTRDVVDLVSSMGGRAILSATGHSLMKAKMRETGAVVGGELSGHIFFNDRWYGFDDGV
YAAARLLEILSMEPFEADEIFAEFPVRASTPEIKIALSDARKFAVMDALAERGEFEGGNM
VKVDGIRVDYPDGWGLIRASNTTPCLIARFEGHDDAALQRIMQIFRAQLQLVEPNLAVSF
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaattcggcaaaaaaggcaaaggccctgcagagaatgagcagaacgacaagcta
ccgtcttctcaaaccgatgcacccagtgctgaaaaaagcaaacccaaacgcgagggaaat
agtttgggtggcttggcggtggggtttcttccagccattgcgggcagcgcggttgcggta
ggcatcgttggcgccctactttacctgcagctcacggccaatcttagtgcttccgcgatg
accaaaatggtgaatgctgatggccagcaactagttcaagcggtggttcaccaaatggac
gcgctccagcaaaacctgaacgttctggcgcgagagcaacaaaccgtgcaggcgattcag
ggaagtacgcccgaagcacaagaagcactggaagaaaattatcgcgctgcactcggcact
gcgaccgtggttcggattacgccactacgcgagggccgcaaagaccgtaagaccacgccg
ccgatcagttttgcccagctcgaaatgatgaaagcggcggagtctggaaaggcgcctgca
cctgagattcaccgtgacaaagagcagttgtatatcagcttggccgttccagttagcaac
gatgggcaagtggttggtacgatctatgccgcgtttgatttcgctccaattcgcaagcag
ttaacggcgcttccagaaaatattggcttttttgaatggcagcaaacgtttcccggttca
cctcctcttgctttggttgccagcggcgatacgcaagcaaaaacaggggctcccattcag
ctcaattggggggtatcgcattgggggattcaggcgtggcctgcagctcatggtggtttg
ttagattcgatcgggcagtccgtattgattggtttcggcattgcggcgctattggtcgcg
gctcttggtggggttagcctatttttggtaaaccgacaactgcgcaacaatgcaacactg
ttctctggacagcttcaagcaatcctgagccgcagcaagtccaacccacgctactcgatt
cctctgtttgaatcgctggcacagcgcgtcgatcgcctgttttatgaatacgacgcgcag
ttgcgccgccatgcggcacccgccgcctccacatcagcagcaggcgcgactgcaagcttt
gccgcagacgacgatccgttagacattcatctgcatgaggacgatcaagacctgttgggc
gccacacccattgccaacccatcagcacctctcacctcgaaacttccctctgacgatgcc
ttggatctggacgatcttgaactctcagatgaacccttcagcacgccgagcatgccagca
gcggatattgggcccatcgcaccggaaatcttccgtgcgtacgatattcgcggagtggtc
aatcaagagctaactccggcggttgcgtgcgccattggcggggccatcggagcaatggcg
aagcttgcagggcagtccaaaatcgtggtcgcgcgagacggtcggctttctagcgaagca
ctcacgcaaggtttaattgagggcttgattggggctgggctgcgtgtggtggacatcgga
atggtgccgacaccggttttgtactacgccacccagacgcttgatacgcaatcgggcgta
gtcgtcaccggcagtcacaatccacctgagtataacggctttaaggttgtaatcgcgggt
gttgcgcttgcgggcagccaaatccaagagcttcgcaaacacatcgaagcgggtgttccc
acaaacatgagtggcacatacgagcgctacgaaatcctgaaagcgtatcgtaaccggatc
accaacgacgttgtattggccaaacccatgcgaatcgtactggattgtggcaacggtgtc
gcaggtgtggtggcgccggagattttggatcgcatcggctgtaccgtgacgactcttttt
ggggaggtggatggcaacttcccgaatcaccaccccgacccaagcattgaggaaaactta
gcggctttgattgccaaagtgcgcgaaacaggcgcagatcttggggttgcgttggatggc
gatggcgatcgcatcggaatcgtcaccaagcaaggccagatcatttggcccgatcgcctg
ttaatgctatttgcccgcgacctgttatcacgcaatccgggcgcggatgtcgtatatgac
gtcaaatgcacacgcgatgtagttgatttggttagcagcatgggtggacgcgcaatcctc
agcgccacagggcattcgctaatgaaagccaagatgcgcgaaaccggagcggttgtcggg
ggcgagctttcgggccatatctttttcaacgaccgctggtatggctttgacgatggcgtt
tatgcggcagcacgattattggaaatcctgtcgatggagccctttgaggccgacgagatt
ttcgctgagtttccggtgcgcgctagtacgccagagatcaaaattgcgctaagcgacgct
cgcaagtttgcggtgatggacgcgctcgcggagcgtggagaatttgaaggcggaaatatg
gtgaaggtggatgggatcagggtagactatcccgacggttggggactgatccgcgcatcg
aacacaaccccttgcctgatcgcacgttttgaggggcatgacgacgctgcactgcaacgt
atcatgcagatctttcgcgctcagctacagctcgtcgaaccgaatttggccgtctctttt
tga

DBGET integrated database retrieval system