KEGG   Gamma proteobacterium HdN1: HDN1F_05850Help
Entry
HDN1F_05850       CDS       T01300                                 

Gene name
sdhD
Definition
succinate dehydrogenase, membrane anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
gpb  Gamma proteobacterium HdN1
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HDN1F_05850 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HDN1F_05850 (sdhD)
   00650 Butanoate metabolism
    HDN1F_05850 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    HDN1F_05850 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
730617..730985
Genome map
AA seq 122 aa AA seqDB search
MVINITNFARSGLYDWMAQRVSAVVIAAYSLFLMGYLFFGATPDYAAWHALFSQTWMRIF
SLLALISIAVHAWVGMWTITTDYLTTRLLGPKGTALRFGAQVVCGILNFVVFVWGVQVIW
GF
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaatcaatatcaccaactttgcgcgctccggtctgtacgactggatggcacagcgc
gtttcagcggtagtaatcgctgcgtatagcttgtttttgatgggctacctgttttttggc
gcaacgcccgactacgcggcgtggcatgcgctgttctcgcaaacttggatgcgtatcttc
agcttgctggctctgatttcgatcgccgtgcacgcatgggtaggcatgtggaccatcacc
accgattacctcacgacccggctgctcggcccgaaagggactgccctgcgctttggcgca
caggtggtgtgcggcattttgaacttcgtggtgtttgtgtggggcgtacaggttatctgg
ggtttttaa

DBGET integrated database retrieval system