KEGG   Gamma proteobacterium HdN1: HDN1F_05850Help
Entry
HDN1F_05850       CDS       T01300                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase, membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
gpb  Gamma proteobacterium HdN1
Pathway
gpb00020  Citrate cycle (TCA cycle)
gpb00190  Oxidative phosphorylation
gpb00650  Butanoate metabolism
gpb01100  Metabolic pathways
gpb01110  Biosynthesis of secondary metabolites
gpb01120  Microbial metabolism in diverse environments
gpb01130  Biosynthesis of antibiotics
gpb01200  Carbon metabolism
Module
gpb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gpb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
gpb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HDN1F_05850 (sdhD)
   00650 Butanoate metabolism
    HDN1F_05850 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    HDN1F_05850 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: CBL44168
UniProt: E1VH76
Position
730617..730985
Genome map
AA seq 122 aa AA seqDB search
MVINITNFARSGLYDWMAQRVSAVVIAAYSLFLMGYLFFGATPDYAAWHALFSQTWMRIF
SLLALISIAVHAWVGMWTITTDYLTTRLLGPKGTALRFGAQVVCGILNFVVFVWGVQVIW
GF
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaatcaatatcaccaactttgcgcgctccggtctgtacgactggatggcacagcgc
gtttcagcggtagtaatcgctgcgtatagcttgtttttgatgggctacctgttttttggc
gcaacgcccgactacgcggcgtggcatgcgctgttctcgcaaacttggatgcgtatcttc
agcttgctggctctgatttcgatcgccgtgcacgcatgggtaggcatgtggaccatcacc
accgattacctcacgacccggctgctcggcccgaaagggactgccctgcgctttggcgca
caggtggtgtgcggcattttgaacttcgtggtgtttgtgtggggcgtacaggttatctgg
ggtttttaa

DBGET integrated database retrieval system